Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1749915..1750552 | Replicon | chromosome |
Accession | NZ_CP097588 | ||
Organism | Bacillus velezensis strain UA0323 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8961_RS08485 | Protein ID | WP_003156187.1 |
Coordinates | 1749915..1750265 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8961_RS08490 | Protein ID | WP_003156188.1 |
Coordinates | 1750271..1750552 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8961_RS08445 | 1744955..1745557 | - | 603 | WP_012116871.1 | PP2C family serine/threonine-protein phosphatase | - |
M8961_RS08450 | 1745557..1746345 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M8961_RS08455 | 1746311..1746793 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8961_RS08460 | 1746790..1747119 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8961_RS08465 | 1747183..1748190 | - | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
M8961_RS08470 | 1748202..1748603 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8961_RS08475 | 1748606..1748971 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8961_RS08480 | 1748976..1749797 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8961_RS08485 | 1749915..1750265 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8961_RS08490 | 1750271..1750552 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8961_RS08495 | 1750672..1751841 | - | 1170 | WP_012116870.1 | alanine racemase | - |
M8961_RS08500 | 1751958..1752965 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
M8961_RS08505 | 1753130..1753495 | - | 366 | WP_012116869.1 | holo-ACP synthase | - |
M8961_RS08510 | 1753588..1754187 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245640 WP_003156187.1 NZ_CP097588:c1750265-1749915 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|