Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 124972..125609 | Replicon | chromosome |
Accession | NZ_CP097587 | ||
Organism | Bacillus velezensis strain UA0276 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M8957_RS00690 | Protein ID | WP_003156187.1 |
Coordinates | 124972..125322 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M8957_RS00695 | Protein ID | WP_003156188.1 |
Coordinates | 125328..125609 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8957_RS00650 | 120012..120614 | - | 603 | WP_012116871.1 | PP2C family serine/threonine-protein phosphatase | - |
M8957_RS00655 | 120614..121402 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M8957_RS00660 | 121368..121850 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M8957_RS00665 | 121847..122176 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M8957_RS00670 | 122240..123247 | - | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
M8957_RS00675 | 123259..123660 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M8957_RS00680 | 123663..124028 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M8957_RS00685 | 124033..124854 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M8957_RS00690 | 124972..125322 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M8957_RS00695 | 125328..125609 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M8957_RS00700 | 125729..126898 | - | 1170 | WP_012116870.1 | alanine racemase | - |
M8957_RS00705 | 127015..128022 | - | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
M8957_RS00710 | 128187..128552 | - | 366 | WP_012116869.1 | holo-ACP synthase | - |
M8957_RS00715 | 128645..129244 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245637 WP_003156187.1 NZ_CP097587:c125322-124972 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|