Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2122083..2123000 | Replicon | chromosome |
Accession | NZ_CP097585 | ||
Organism | Bacillus velezensis strain UA1365 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | M8964_RS10900 | Protein ID | WP_012117368.1 |
Coordinates | 2122254..2123000 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8964_RS10895 | Protein ID | WP_003154807.1 |
Coordinates | 2122083..2122253 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8964_RS10845 | 2117217..2117729 | + | 513 | WP_012117362.1 | sigma-70 family RNA polymerase sigma factor | - |
M8964_RS10850 | 2117842..2118075 | + | 234 | WP_012117363.1 | XtmA | - |
M8964_RS10855 | 2118091..2118939 | + | 849 | WP_012117364.1 | hypothetical protein | - |
M8964_RS10860 | 2118952..2119323 | + | 372 | WP_012117365.1 | XkdW family protein | - |
M8964_RS10865 | 2119328..2119525 | + | 198 | WP_012117366.1 | XkdX family protein | - |
M8964_RS10870 | 2119582..2120343 | + | 762 | WP_012117367.1 | hypothetical protein | - |
M8964_RS10875 | 2120395..2120658 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8964_RS10880 | 2120672..2120935 | + | 264 | WP_003154813.1 | phage holin | - |
M8964_RS10885 | 2120949..2121827 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8964_RS10895 | 2122083..2122253 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8964_RS10900 | 2122254..2123000 | - | 747 | WP_012117368.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8964_RS10905 | 2123105..2124103 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
M8964_RS10910 | 2124116..2124733 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M8964_RS10915 | 2125019..2126335 | - | 1317 | WP_007610842.1 | amino acid permease | - |
M8964_RS10920 | 2126658..2127608 | + | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2108151..2180287 | 72136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29119.61 Da Isoelectric Point: 4.7003
>T245636 WP_012117368.1 NZ_CP097585:c2123000-2122254 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQADKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|