Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1199855..1200492 | Replicon | chromosome |
| Accession | NZ_CP097585 | ||
| Organism | Bacillus velezensis strain UA1365 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | M8964_RS06035 | Protein ID | WP_003156187.1 |
| Coordinates | 1200142..1200492 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | M8964_RS06030 | Protein ID | WP_003156188.1 |
| Coordinates | 1199855..1200136 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8964_RS06010 | 1196220..1196819 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| M8964_RS06015 | 1196912..1197277 | + | 366 | WP_012116869.1 | holo-ACP synthase | - |
| M8964_RS06020 | 1197442..1198449 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| M8964_RS06025 | 1198566..1199735 | + | 1170 | WP_012116870.1 | alanine racemase | - |
| M8964_RS06030 | 1199855..1200136 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| M8964_RS06035 | 1200142..1200492 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M8964_RS06040 | 1200610..1201431 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| M8964_RS06045 | 1201436..1201801 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| M8964_RS06050 | 1201804..1202205 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| M8964_RS06055 | 1202217..1203224 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
| M8964_RS06060 | 1203288..1203617 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| M8964_RS06065 | 1203614..1204096 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| M8964_RS06070 | 1204062..1204850 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| M8964_RS06075 | 1204850..1205452 | + | 603 | WP_012116871.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245635 WP_003156187.1 NZ_CP097585:1200142-1200492 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|