Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 568808..569479 | Replicon | chromosome |
| Accession | NZ_CP097577 | ||
| Organism | Streptococcus suis strain 3112 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | M8286_RS02870 | Protein ID | WP_014637653.1 |
| Coordinates | 568808..568990 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M8286_RS02875 | Protein ID | WP_024404710.1 |
| Coordinates | 569030..569479 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8286_RS02855 (M8286_02850) | 565635..566102 | + | 468 | WP_024386304.1 | SsrA-binding protein SmpB | - |
| M8286_RS02860 (M8286_02855) | 566366..567049 | + | 684 | WP_105133780.1 | hypothetical protein | - |
| M8286_RS02865 (M8286_02860) | 567051..567770 | + | 720 | WP_275601412.1 | ABC transporter ATP-binding protein | - |
| M8286_RS02870 (M8286_02865) | 568808..568990 | + | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M8286_RS02875 (M8286_02870) | 569030..569479 | + | 450 | WP_024404710.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M8286_RS02880 (M8286_02875) | 569639..570682 | - | 1044 | WP_275601704.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| M8286_RS02885 (M8286_02880) | 570836..571696 | + | 861 | WP_044781786.1 | SAM-dependent methyltransferase TehB | - |
| M8286_RS02890 (M8286_02885) | 571889..573742 | + | 1854 | WP_275601413.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T245632 WP_014637653.1 NZ_CP097577:568808-568990 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16654.66 Da Isoelectric Point: 4.0193
>AT245632 WP_024404710.1 NZ_CP097577:569030-569479 [Streptococcus suis]
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|