Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT_toxin-BrnA |
| Location | 4164573..4165065 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | I4GAG4 |
| Locus tag | M8120_RS21030 | Protein ID | WP_002772034.1 |
| Coordinates | 4164573..4164851 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | M8120_RS21035 | Protein ID | WP_081417880.1 |
| Coordinates | 4164856..4165065 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS21000 (M8120_20805) | 4159580..4160037 | + | 458 | Protein_4164 | transposase | - |
| M8120_RS21005 (M8120_20810) | 4160201..4160902 | + | 702 | WP_190359245.1 | NnrU family protein | - |
| M8120_RS21010 (M8120_20815) | 4160991..4161401 | + | 411 | WP_265795870.1 | thioredoxin family protein | - |
| M8120_RS21015 (M8120_20820) | 4161318..4162528 | - | 1211 | Protein_4167 | ISL3 family transposase | - |
| M8120_RS21020 (M8120_20825) | 4163022..4163678 | + | 657 | WP_190359244.1 | VWA domain-containing protein | - |
| M8120_RS21025 (M8120_20830) | 4163692..4164459 | + | 768 | WP_190359243.1 | PP2C family serine/threonine-protein phosphatase | - |
| M8120_RS21030 (M8120_20835) | 4164573..4164851 | + | 279 | WP_002772034.1 | BrnT family toxin | Toxin |
| M8120_RS21035 (M8120_20840) | 4164856..4165065 | + | 210 | WP_081417880.1 | BrnA antitoxin family protein | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4150368..4175780 | 25412 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10835.42 Da Isoelectric Point: 9.9743
>T245630 WP_002772034.1 NZ_CP097576:4164573-4164851 [Microcystis aeruginosa str. Chao 1910]
MKYEWDQDKSDANLEKHGLSFEDAPLVFGGKCVTFEDSRFVYGEIRYITLGKLKGRVVLIVHTPRSNKTRIISMRKANNR
EQKIYQKRLEEN
MKYEWDQDKSDANLEKHGLSFEDAPLVFGGKCVTFEDSRFVYGEIRYITLGKLKGRVVLIVHTPRSNKTRIISMRKANNR
EQKIYQKRLEEN
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|