Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3734055..3734668 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M8120_RS18845 | Protein ID | WP_190357894.1 |
| Coordinates | 3734282..3734668 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M8120_RS18840 | Protein ID | WP_190357893.1 |
| Coordinates | 3734055..3734282 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS18825 (M8120_18650) | 3731584..3731829 | + | 246 | WP_190358710.1 | hypothetical protein | - |
| M8120_RS18830 (M8120_18655) | 3731819..3732520 | - | 702 | WP_265795427.1 | hypothetical protein | - |
| M8120_RS18835 (M8120_18660) | 3733534..3734013 | + | 480 | WP_190357892.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
| M8120_RS18840 (M8120_18665) | 3734055..3734282 | + | 228 | WP_190357893.1 | DUF2281 domain-containing protein | Antitoxin |
| M8120_RS18845 (M8120_18670) | 3734282..3734668 | + | 387 | WP_190357894.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M8120_RS18850 (M8120_18675) | 3734761..3736518 | + | 1758 | WP_190357895.1 | arginine--tRNA ligase | - |
| M8120_RS18855 (M8120_18680) | 3737259..3737651 | + | 393 | WP_190358883.1 | Mo-dependent nitrogenase C-terminal domain-containing protein | - |
| M8120_RS18860 (M8120_18685) | 3737682..3738440 | + | 759 | WP_190358884.1 | hypothetical protein | - |
| M8120_RS18865 (M8120_18690) | 3738446..3738697 | + | 252 | WP_012266136.1 | hypothetical protein | - |
| M8120_RS18870 (M8120_18695) | 3738740..3739147 | - | 408 | WP_190358885.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14825.11 Da Isoelectric Point: 4.8942
>T245629 WP_190357894.1 NZ_CP097576:3734282-3734668 [Microcystis aeruginosa str. Chao 1910]
MTSFLLDTHTFIWLTENDPNLPDNLREEIDFAPEVYVSIVSLWEIAIKLNLGKLALQKSYETIETKLEASDITLLSISFS
DTLKICTLPLHHRDPFDRMLIAQSINRTLILISKDTKFDAYNVPRKWT
MTSFLLDTHTFIWLTENDPNLPDNLREEIDFAPEVYVSIVSLWEIAIKLNLGKLALQKSYETIETKLEASDITLLSISFS
DTLKICTLPLHHRDPFDRMLIAQSINRTLILISKDTKFDAYNVPRKWT
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|