Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 3162165..3162736 | Replicon | chromosome |
Accession | NZ_CP097576 | ||
Organism | Microcystis aeruginosa str. Chao 1910 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | I4IBX6 |
Locus tag | M8120_RS15875 | Protein ID | WP_002759489.1 |
Coordinates | 3162165..3162506 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M8120_RS15880 | Protein ID | WP_190359069.1 |
Coordinates | 3162503..3162736 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8120_RS15855 (M8120_15715) | 3157177..3157458 | - | 282 | WP_190359065.1 | DUF6439 family protein | - |
M8120_RS15860 (M8120_15720) | 3157531..3157932 | + | 402 | WP_190359066.1 | DUF2203 domain-containing protein | - |
M8120_RS15865 (M8120_15725) | 3158258..3159508 | - | 1251 | WP_190359067.1 | methionine adenosyltransferase | - |
M8120_RS15870 (M8120_15730) | 3159834..3162155 | + | 2322 | WP_190359068.1 | DNA helicase PcrA | - |
M8120_RS15875 (M8120_15735) | 3162165..3162506 | - | 342 | WP_002759489.1 | DUF5615 family PIN-like protein | Toxin |
M8120_RS15880 (M8120_15740) | 3162503..3162736 | - | 234 | WP_190359069.1 | DUF433 domain-containing protein | Antitoxin |
M8120_RS15885 (M8120_15745) | 3163062..3163493 | + | 432 | WP_045358126.1 | CAAD domain-containing protein | - |
M8120_RS15890 (M8120_15750) | 3164062..3165234 | - | 1173 | WP_190359070.1 | CBS domain-containing protein | - |
M8120_RS15895 (M8120_15755) | 3165473..3165880 | - | 408 | WP_242030190.1 | recombinase family protein | - |
M8120_RS15900 (M8120_15760) | 3166188..3166511 | + | 324 | WP_002790944.1 | thioredoxin | - |
M8120_RS15905 (M8120_15765) | 3166585..3166905 | + | 321 | WP_242030191.1 | hypothetical protein | - |
M8120_RS15910 (M8120_15770) | 3166957..3167574 | + | 618 | WP_002746099.1 | CBS domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12508.41 Da Isoelectric Point: 4.2544
>T245627 WP_002759489.1 NZ_CP097576:c3162506-3162165 [Microcystis aeruginosa str. Chao 1910]
MKIWIDAQLPPTLASWLSATFDLEASSLRDLSLRDAQDIEIFAAARAENAVIMTKDSDFIDLVCRLGTPPQILWLTCGNV
TNQNLRRLLTATLPDALKQLEQGTIIVEISNTP
MKIWIDAQLPPTLASWLSATFDLEASSLRDLSLRDAQDIEIFAAARAENAVIMTKDSDFIDLVCRLGTPPQILWLTCGNV
TNQNLRRLLTATLPDALKQLEQGTIIVEISNTP
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|