Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3047960..3048741 | Replicon | chromosome |
Accession | NZ_CP097576 | ||
Organism | Microcystis aeruginosa str. Chao 1910 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M8120_RS15330 | Protein ID | WP_052276780.1 |
Coordinates | 3048247..3048741 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | M8120_RS15325 | Protein ID | WP_190359866.1 |
Coordinates | 3047960..3048250 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8120_RS15295 (M8120_15165) | 3044125..3044439 | + | 315 | WP_190359951.1 | hypothetical protein | - |
M8120_RS15300 (M8120_15170) | 3044459..3045408 | + | 950 | WP_265795351.1 | IS630-like element ISMae26 family transposase | - |
M8120_RS15305 (M8120_15175) | 3045482..3045982 | + | 501 | WP_190359865.1 | hypothetical protein | - |
M8120_RS15310 (M8120_15180) | 3046242..3046490 | + | 249 | WP_190359921.1 | BrnT family toxin | - |
M8120_RS15315 (M8120_15185) | 3046468..3046740 | + | 273 | WP_012266237.1 | hypothetical protein | - |
M8120_RS15320 | 3047397..3047519 | - | 123 | WP_265795352.1 | hypothetical protein | - |
M8120_RS15325 (M8120_15190) | 3047960..3048250 | + | 291 | WP_190359866.1 | DUF1778 domain-containing protein | Antitoxin |
M8120_RS15330 (M8120_15195) | 3048247..3048741 | + | 495 | WP_052276780.1 | GNAT family N-acetyltransferase | Toxin |
M8120_RS15335 (M8120_15200) | 3048893..3049375 | - | 483 | WP_190359867.1 | hypothetical protein | - |
M8120_RS15340 (M8120_15205) | 3049372..3049746 | - | 375 | WP_002757633.1 | nucleotidyltransferase domain-containing protein | - |
M8120_RS15345 (M8120_15210) | 3049863..3050024 | + | 162 | WP_265795353.1 | hypothetical protein | - |
M8120_RS15350 (M8120_15215) | 3050233..3050550 | + | 318 | WP_002768334.1 | 2Fe-2S iron-sulfur cluster-binding protein | - |
M8120_RS15355 (M8120_15220) | 3050633..3052273 | - | 1641 | WP_190359868.1 | CTP synthase | - |
M8120_RS15360 (M8120_15225) | 3052514..3052912 | + | 399 | WP_190359869.1 | hypothetical protein | - |
M8120_RS15365 (M8120_15230) | 3052922..3053692 | - | 771 | WP_190359870.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3040335..3049746 | 9411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17620.32 Da Isoelectric Point: 8.1215
>T245626 WP_052276780.1 NZ_CP097576:3048247-3048741 [Microcystis aeruginosa str. Chao 1910]
MNLTPPEPLASYHSITDFSCGITSLDDWLKRRAYANQASGATRTFVTCVDNRVVGYYALASGAISIQSANGKFRRNMPNP
IPVVILARLAVDTSSQGQGLGCGLFRDGALRVVKAADTIGIRGIIVHAISEEAKNFYLALGFDVSPLEPMTLMITLNDLR
ACIA
MNLTPPEPLASYHSITDFSCGITSLDDWLKRRAYANQASGATRTFVTCVDNRVVGYYALASGAISIQSANGKFRRNMPNP
IPVVILARLAVDTSSQGQGLGCGLFRDGALRVVKAADTIGIRGIIVHAISEEAKNFYLALGFDVSPLEPMTLMITLNDLR
ACIA
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|