Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 2674463..2674970 | Replicon | chromosome |
Accession | NZ_CP097576 | ||
Organism | Microcystis aeruginosa str. Chao 1910 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | M8120_RS13440 | Protein ID | WP_043997958.1 |
Coordinates | 2674701..2674970 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M8120_RS13435 | Protein ID | WP_190358662.1 |
Coordinates | 2674463..2674711 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8120_RS13410 (M8120_13280) | 2669572..2670213 | - | 642 | WP_151696328.1 | LON peptidase substrate-binding domain-containing protein | - |
M8120_RS13415 (M8120_13285) | 2670976..2671932 | + | 957 | WP_190358660.1 | RNA polymerase sigma factor, RpoD/SigA family | - |
M8120_RS13420 (M8120_13290) | 2672026..2672913 | - | 888 | WP_190358661.1 | S-methyl-5'-thioadenosine phosphorylase | - |
M8120_RS13425 (M8120_13295) | 2672996..2673322 | - | 327 | WP_002748322.1 | urease subunit beta | - |
M8120_RS13430 (M8120_13300) | 2673342..2673644 | - | 303 | WP_002738360.1 | urease subunit gamma | - |
M8120_RS13435 (M8120_13305) | 2674463..2674711 | - | 249 | WP_190358662.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M8120_RS13440 (M8120_13310) | 2674701..2674970 | - | 270 | WP_043997958.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M8120_RS13445 (M8120_13315) | 2675178..2675504 | + | 327 | WP_190358663.1 | DUF433 domain-containing protein | - |
M8120_RS13450 (M8120_13320) | 2675508..2675849 | + | 342 | WP_002757208.1 | DUF5615 family PIN-like protein | - |
M8120_RS13455 (M8120_13325) | 2676363..2676770 | - | 408 | Protein_2664 | formylglycine-generating enzyme family protein | - |
M8120_RS13460 (M8120_13330) | 2676858..2677947 | + | 1090 | Protein_2665 | ISAs1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10150.69 Da Isoelectric Point: 10.0825
>T245625 WP_043997958.1 NZ_CP097576:c2674970-2674701 [Microcystis aeruginosa str. Chao 1910]
MALSKKQRKILDQIFEQPVRSDVVWTDIESLLEALGAEISEGRRLRVWVALKGVKAVFHRPHPRRETDKGAVVSVRRFLS
EAGVENDEV
MALSKKQRKILDQIFEQPVRSDVVWTDIESLLEALGAEISEGRRLRVWVALKGVKAVFHRPHPRRETDKGAVVSVRRFLS
EAGVENDEV
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|