Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 2597701..2598341 | Replicon | chromosome |
Accession | NZ_CP097576 | ||
Organism | Microcystis aeruginosa str. Chao 1910 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M8120_RS13070 | Protein ID | WP_190357215.1 |
Coordinates | 2597701..2598099 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | S3JHM9 |
Locus tag | M8120_RS13075 | Protein ID | WP_016514827.1 |
Coordinates | 2598096..2598341 (-) | Length | 82 a.a. |
Genomic Context
Location: 2593716..2594129 (414 bp)
Type: Others
Protein ID: WP_190357212.1
Type: Others
Protein ID: WP_190357212.1
Location: 2594401..2594631 (231 bp)
Type: Others
Protein ID: WP_002779924.1
Type: Others
Protein ID: WP_002779924.1
Location: 2594635..2594958 (324 bp)
Type: Others
Protein ID: WP_190357213.1
Type: Others
Protein ID: WP_190357213.1
Location: 2596210..2596356 (147 bp)
Type: Others
Protein ID: WP_002738886.1
Type: Others
Protein ID: WP_002738886.1
Location: 2596547..2596792 (246 bp)
Type: Others
Protein ID: WP_002770883.1
Type: Others
Protein ID: WP_002770883.1
Location: 2596789..2597274 (486 bp)
Type: Others
Protein ID: WP_190357214.1
Type: Others
Protein ID: WP_190357214.1
Location: 2598693..2599172 (480 bp)
Type: Others
Protein ID: WP_002738680.1
Type: Others
Protein ID: WP_002738680.1
Location: 2601299..2601847 (549 bp)
Type: Others
Protein ID: WP_190357217.1
Type: Others
Protein ID: WP_190357217.1
Location: 2594935..2595999 (1065 bp)
Type: Others
Protein ID: Protein_2584
Type: Others
Protein ID: Protein_2584
Location: 2597300..2597548 (249 bp)
Type: Others
Protein ID: WP_242030029.1
Type: Others
Protein ID: WP_242030029.1
Location: 2597701..2598099 (399 bp)
Type: Toxin
Protein ID: WP_190357215.1
Type: Toxin
Protein ID: WP_190357215.1
Location: 2598096..2598341 (246 bp)
Type: Antitoxin
Protein ID: WP_016514827.1
Type: Antitoxin
Protein ID: WP_016514827.1
Location: 2599300..2600457 (1158 bp)
Type: Others
Protein ID: WP_190357216.1
Type: Others
Protein ID: WP_190357216.1
Location: 2600525..2600884 (360 bp)
Type: Others
Protein ID: WP_002763426.1
Type: Others
Protein ID: WP_002763426.1
Location: 2602232..2602423 (192 bp)
Type: Others
Protein ID: WP_045356121.1
Type: Others
Protein ID: WP_045356121.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8120_RS13030 (M8120_12900) | 2593716..2594129 | + | 414 | WP_190357212.1 | hypothetical protein | - |
M8120_RS13035 (M8120_12905) | 2594401..2594631 | + | 231 | WP_002779924.1 | DUF433 domain-containing protein | - |
M8120_RS13040 (M8120_12910) | 2594635..2594958 | + | 324 | WP_190357213.1 | DUF5615 family PIN-like protein | - |
M8120_RS13045 (M8120_12915) | 2594935..2595999 | - | 1065 | Protein_2584 | IS4 family transposase | - |
M8120_RS13050 (M8120_12920) | 2596210..2596356 | + | 147 | WP_002738886.1 | PEP-CTERM sorting domain-containing protein | - |
M8120_RS13055 (M8120_12925) | 2596547..2596792 | + | 246 | WP_002770883.1 | UPF0175 family protein | - |
M8120_RS13060 (M8120_12930) | 2596789..2597274 | + | 486 | WP_190357214.1 | DUF3368 domain-containing protein | - |
M8120_RS13065 (M8120_12935) | 2597300..2597548 | - | 249 | WP_242030029.1 | hypothetical protein | - |
M8120_RS13070 (M8120_12940) | 2597701..2598099 | - | 399 | WP_190357215.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M8120_RS13075 (M8120_12945) | 2598096..2598341 | - | 246 | WP_016514827.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M8120_RS13080 (M8120_12950) | 2598693..2599172 | + | 480 | WP_002738680.1 | type II toxin-antitoxin system VapC family toxin | - |
M8120_RS13085 (M8120_12955) | 2599300..2600457 | - | 1158 | WP_190357216.1 | 8-amino-7-oxononanoate synthase | - |
M8120_RS13090 (M8120_12960) | 2600525..2600884 | - | 360 | WP_002763426.1 | DUF6464 family protein | - |
M8120_RS13095 (M8120_12965) | 2601299..2601847 | + | 549 | WP_190357217.1 | RDD family protein | - |
M8120_RS13105 (M8120_12975) | 2602232..2602423 | - | 192 | WP_045356121.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15000.09 Da Isoelectric Point: 4.5069
>T245624 WP_190357215.1 NZ_CP097576:c2598099-2597701 [Microcystis aeruginosa str. Chao 1910]
VRLLLDTQCWLWWFVQPDKLSENVIEQIANESNEVWFSVASVWEMGIKVSIGKLPLPEQIDNYVSTRMTQLGARSLEINA
SHALRAAALPLHHRDPFDRMLIAQAQVEDMTLVSADSTFNQYEVSLLWAASS
VRLLLDTQCWLWWFVQPDKLSENVIEQIANESNEVWFSVASVWEMGIKVSIGKLPLPEQIDNYVSTRMTQLGARSLEINA
SHALRAAALPLHHRDPFDRMLIAQAQVEDMTLVSADSTFNQYEVSLLWAASS
Download Length: 399 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3N0W8U9 |