Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 2597701..2598341 Replicon chromosome
Accession NZ_CP097576
Organism Microcystis aeruginosa str. Chao 1910

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M8120_RS13070 Protein ID WP_190357215.1
Coordinates 2597701..2598099 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID S3JHM9
Locus tag M8120_RS13075 Protein ID WP_016514827.1
Coordinates 2598096..2598341 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8120_RS13030 (M8120_12900) 2593716..2594129 + 414 WP_190357212.1 hypothetical protein -
M8120_RS13035 (M8120_12905) 2594401..2594631 + 231 WP_002779924.1 DUF433 domain-containing protein -
M8120_RS13040 (M8120_12910) 2594635..2594958 + 324 WP_190357213.1 DUF5615 family PIN-like protein -
M8120_RS13045 (M8120_12915) 2594935..2595999 - 1065 Protein_2584 IS4 family transposase -
M8120_RS13050 (M8120_12920) 2596210..2596356 + 147 WP_002738886.1 PEP-CTERM sorting domain-containing protein -
M8120_RS13055 (M8120_12925) 2596547..2596792 + 246 WP_002770883.1 UPF0175 family protein -
M8120_RS13060 (M8120_12930) 2596789..2597274 + 486 WP_190357214.1 DUF3368 domain-containing protein -
M8120_RS13065 (M8120_12935) 2597300..2597548 - 249 WP_242030029.1 hypothetical protein -
M8120_RS13070 (M8120_12940) 2597701..2598099 - 399 WP_190357215.1 type II toxin-antitoxin system VapC family toxin Toxin
M8120_RS13075 (M8120_12945) 2598096..2598341 - 246 WP_016514827.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M8120_RS13080 (M8120_12950) 2598693..2599172 + 480 WP_002738680.1 type II toxin-antitoxin system VapC family toxin -
M8120_RS13085 (M8120_12955) 2599300..2600457 - 1158 WP_190357216.1 8-amino-7-oxononanoate synthase -
M8120_RS13090 (M8120_12960) 2600525..2600884 - 360 WP_002763426.1 DUF6464 family protein -
M8120_RS13095 (M8120_12965) 2601299..2601847 + 549 WP_190357217.1 RDD family protein -
M8120_RS13105 (M8120_12975) 2602232..2602423 - 192 WP_045356121.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-128)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-41)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15000.09 Da        Isoelectric Point: 4.5069

>T245624 WP_190357215.1 NZ_CP097576:c2598099-2597701 [Microcystis aeruginosa str. Chao 1910]
VRLLLDTQCWLWWFVQPDKLSENVIEQIANESNEVWFSVASVWEMGIKVSIGKLPLPEQIDNYVSTRMTQLGARSLEINA
SHALRAAALPLHHRDPFDRMLIAQAQVEDMTLVSADSTFNQYEVSLLWAASS

Download         Length: 399 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8858.15 Da        Isoelectric Point: 5.0190

>AT245624 WP_016514827.1 NZ_CP097576:c2598341-2598096 [Microcystis aeruginosa str. Chao 1910]
METVNIHQAKTNLSRLLSRVELGEVIVISNRGIPIAKLVPFRTSLDRRSSLGQDRGMLTIPDDFNAPLPEDILGAFEGGA
E

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3N0W8U9

References