Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2100705..2101128 Replicon chromosome
Accession NZ_CP097576
Organism Microcystis aeruginosa str. Chao 1910

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag M8120_RS10615 Protein ID WP_242030108.1
Coordinates 2100922..2101128 (+) Length 69 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag M8120_RS10610 Protein ID WP_190358011.1
Coordinates 2100705..2100929 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8120_RS10585 (M8120_10485) 2095762..2096043 - 282 WP_190358012.1 hypothetical protein -
M8120_RS10590 (M8120_10490) 2096121..2098586 - 2466 WP_002732350.1 ATP-dependent Clp protease ATP-binding subunit -
M8120_RS10595 (M8120_10495) 2099149..2099373 + 225 WP_008199613.1 addiction module protein -
M8120_RS10600 (M8120_10500) 2099370..2099666 + 297 WP_052275568.1 type II toxin-antitoxin system RelE/ParE family toxin -
M8120_RS10605 (M8120_10505) 2099902..2100168 + 267 WP_002733164.1 hypothetical protein -
M8120_RS10610 (M8120_10510) 2100705..2100929 + 225 WP_190358011.1 hypothetical protein Antitoxin
M8120_RS10615 (M8120_10515) 2100922..2101128 + 207 WP_242030108.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M8120_RS10620 (M8120_10520) 2101320..2101490 + 171 WP_265795784.1 hypothetical protein -
M8120_RS10625 (M8120_10525) 2101922..2102164 + 243 WP_016515139.1 type II toxin-antitoxin system HicB family antitoxin -
M8120_RS10630 (M8120_10530) 2102161..2102373 + 213 WP_190358010.1 type II toxin-antitoxin system HicA family toxin -
M8120_RS10635 (M8120_10535) 2102523..2102963 + 441 WP_190358009.1 DUF29 domain-containing protein -
M8120_RS10640 (M8120_10540) 2103306..2104079 + 774 WP_190358008.1 hypothetical protein -
M8120_RS10645 (M8120_10545) 2104314..2104589 + 276 WP_190358007.1 hypothetical protein -
M8120_RS10650 (M8120_10550) 2104806..2104943 + 138 WP_242030107.1 hypothetical protein -
M8120_RS10655 (M8120_10555) 2104965..2105810 + 846 WP_193958915.1 IS5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-57)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 69 a.a.        Molecular weight: 7603.84 Da        Isoelectric Point: 9.6277

>T245623 WP_242030108.1 NZ_CP097576:2100922-2101128 [Microcystis aeruginosa str. Chao 1910]
MPNGRLTYKRGEIWWVDLKPVVGYETDKERPCLILQNDIGNQNGTTTIVAPLLPGKKTYGSSLLGMVR

Download         Length: 207 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8606.65 Da        Isoelectric Point: 4.1621

>AT245623 WP_190358011.1 NZ_CP097576:2100705-2100929 [Microcystis aeruginosa str. Chao 1910]
MSKKVSITLDDEVLDFVDRLASNRSRFINDVLWQEKKRVFMKELEDAYKDQANDPEMQEEISVWDIAVGDGLNA

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References