Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1840828..1841418 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | I4GZP8 |
| Locus tag | M8120_RS09240 | Protein ID | WP_002786284.1 |
| Coordinates | 1840828..1841118 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M8120_RS09245 | Protein ID | WP_190359454.1 |
| Coordinates | 1841128..1841418 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS09220 (M8120_09125) | 1836002..1836871 | + | 870 | WP_190359452.1 | bile acid:sodium symporter family protein | - |
| M8120_RS09225 (M8120_09130) | 1837601..1839490 | + | 1890 | WP_190359453.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| M8120_RS09230 (M8120_09135) | 1839687..1840048 | - | 362 | Protein_1829 | IS4 family transposase | - |
| M8120_RS09235 (M8120_09140) | 1840398..1840808 | + | 411 | Protein_1830 | hypothetical protein | - |
| M8120_RS09240 (M8120_09145) | 1840828..1841118 | + | 291 | WP_002786284.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8120_RS09245 (M8120_09150) | 1841128..1841418 | + | 291 | WP_190359454.1 | putative addiction module antidote protein | Antitoxin |
| M8120_RS09250 (M8120_09155) | 1841431..1842507 | - | 1077 | WP_242030231.1 | CHAT domain-containing protein | - |
| M8120_RS09255 (M8120_09160) | 1842711..1843802 | + | 1092 | WP_265795848.1 | ISAs1 family transposase | - |
| M8120_RS09260 (M8120_09165) | 1844253..1846409 | - | 2157 | Protein_1835 | tetratricopeptide repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1839687..1843802 | 4115 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10921.57 Da Isoelectric Point: 10.6201
>T245621 WP_002786284.1 NZ_CP097576:1840828-1841118 [Microcystis aeruginosa str. Chao 1910]
MIEIRQTKTYSEWFSGLRDRQAKARIDIRIRRLSTGNPGDVKPVGQGVSELRVDYGPGYRVYFIQQGKTLIILLAGGDKK
TQERDIKTALDLARNL
MIEIRQTKTYSEWFSGLRDRQAKARIDIRIRRLSTGNPGDVKPVGQGVSELRVDYGPGYRVYFIQQGKTLIILLAGGDKK
TQERDIKTALDLARNL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|