Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1432721..1433292 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A3G9JKW3 |
| Locus tag | M8120_RS07230 | Protein ID | WP_043995641.1 |
| Coordinates | 1432960..1433292 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I4FQ39 |
| Locus tag | M8120_RS07225 | Protein ID | WP_002760402.1 |
| Coordinates | 1432721..1432963 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS07200 (M8120_07110) | 1427829..1428254 | + | 426 | WP_265795731.1 | hypothetical protein | - |
| M8120_RS07205 (M8120_07115) | 1428786..1429247 | - | 462 | WP_190357869.1 | hypothetical protein | - |
| M8120_RS07210 (M8120_07120) | 1429759..1430727 | - | 969 | WP_190357868.1 | helix-turn-helix domain-containing protein | - |
| M8120_RS07215 (M8120_07125) | 1431158..1431820 | + | 663 | WP_190357867.1 | potassium channel family protein | - |
| M8120_RS07220 (M8120_07130) | 1431853..1432629 | + | 777 | WP_190357866.1 | DUF2092 domain-containing protein | - |
| M8120_RS07225 (M8120_07135) | 1432721..1432963 | + | 243 | WP_002760402.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M8120_RS07230 (M8120_07140) | 1432960..1433292 | + | 333 | WP_043995641.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M8120_RS07235 (M8120_07145) | 1433475..1434368 | + | 894 | WP_190357865.1 | DUF6515 family protein | - |
| M8120_RS07240 (M8120_07150) | 1434365..1437427 | - | 3063 | WP_190357864.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12588.65 Da Isoelectric Point: 9.7817
>T245620 WP_043995641.1 NZ_CP097576:1432960-1433292 [Microcystis aeruginosa str. Chao 1910]
VTYIPERGDFLRLSFDPQIGHEQMGNRPALVVSHIDFNRKIGFAFVCPVSNTQRQNPFYVKIPDGEAVTGVIMVDQLRSL
DFRARKASFIGKCPEQLLQDVLRRIKPILF
VTYIPERGDFLRLSFDPQIGHEQMGNRPALVVSHIDFNRKIGFAFVCPVSNTQRQNPFYVKIPDGEAVTGVIMVDQLRSL
DFRARKASFIGKCPEQLLQDVLRRIKPILF
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G9JKW3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I4FQ39 |