Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 843221..843861 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M8120_RS04100 | Protein ID | WP_190356878.1 |
| Coordinates | 843463..843861 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M8120_RS04095 | Protein ID | WP_190356877.1 |
| Coordinates | 843221..843466 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS04060 (M8120_04025) | 839028..840251 | - | 1224 | Protein_806 | transposase | - |
| M8120_RS04065 (M8120_04030) | 840441..840728 | - | 288 | WP_242029995.1 | hypothetical protein | - |
| M8120_RS04070 (M8120_04035) | 840976..841215 | - | 240 | WP_242029996.1 | hypothetical protein | - |
| M8120_RS04075 (M8120_04040) | 841374..841529 | - | 156 | WP_190356886.1 | hypothetical protein | - |
| M8120_RS04080 (M8120_04045) | 841956..842252 | + | 297 | Protein_810 | arginase family protein | - |
| M8120_RS04085 (M8120_04050) | 842291..842617 | - | 327 | WP_002757286.1 | DUF5615 family PIN-like protein | - |
| M8120_RS04090 (M8120_04055) | 842601..842864 | - | 264 | WP_002757287.1 | DUF433 domain-containing protein | - |
| M8120_RS04095 (M8120_04060) | 843221..843466 | + | 246 | WP_190356877.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M8120_RS04100 (M8120_04065) | 843463..843861 | + | 399 | WP_190356878.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M8120_RS04105 (M8120_04070) | 844165..844428 | - | 264 | WP_190356879.1 | DUF2442 domain-containing protein | - |
| M8120_RS04110 (M8120_04075) | 844597..845457 | - | 861 | WP_242029997.1 | PEP-CTERM sorting domain-containing protein | - |
| M8120_RS04115 (M8120_04080) | 845678..846175 | + | 498 | WP_190356880.1 | ATPase | - |
| M8120_RS04120 (M8120_04085) | 846640..847539 | + | 900 | WP_190356881.1 | agmatinase | - |
| M8120_RS04130 (M8120_04095) | 847964..848627 | + | 664 | Protein_819 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 840976..854969 | 13993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14991.04 Da Isoelectric Point: 4.4046
>T245617 WP_190356878.1 NZ_CP097576:843463-843861 [Microcystis aeruginosa str. Chao 1910]
VRILLDTQCWLWWFVQPDKLSENVIEQIANESNEVWFSVASVWEMGIKVSIGKLSLPEQIDDYVSTRMTQLGARSLEINA
SHALRAAALPLHHRDPFDRMLIAQAQVEDMTLVSADSTFNQYEVSLLWAASS
VRILLDTQCWLWWFVQPDKLSENVIEQIANESNEVWFSVASVWEMGIKVSIGKLSLPEQIDDYVSTRMTQLGARSLEINA
SHALRAAALPLHHRDPFDRMLIAQAQVEDMTLVSADSTFNQYEVSLLWAASS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|