Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2929909..2930414 | Replicon | chromosome |
Accession | NZ_CP097575 | ||
Organism | Pseudomonas aeruginosa strain UNC_PaerCF25 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M9A05_RS13520 | Protein ID | WP_003083773.1 |
Coordinates | 2930133..2930414 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M9A05_RS13515 | Protein ID | WP_003083775.1 |
Coordinates | 2929909..2930136 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9A05_RS13490 (M9A05_13490) | 2924927..2926420 | + | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
M9A05_RS13495 (M9A05_13495) | 2926589..2928016 | + | 1428 | WP_003083784.1 | GABA permease | - |
M9A05_RS13500 (M9A05_13500) | 2928098..2928439 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M9A05_RS13505 (M9A05_13505) | 2928512..2929012 | - | 501 | WP_003101228.1 | LEA type 2 family protein | - |
M9A05_RS13510 (M9A05_13510) | 2929113..2929733 | + | 621 | WP_003101226.1 | hypothetical protein | - |
M9A05_RS13515 (M9A05_13515) | 2929909..2930136 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M9A05_RS13520 (M9A05_13520) | 2930133..2930414 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M9A05_RS13525 (M9A05_13525) | 2930714..2931622 | + | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
M9A05_RS13530 (M9A05_13530) | 2931654..2932064 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
M9A05_RS13535 (M9A05_13535) | 2932260..2932979 | - | 720 | Protein_2680 | GntR family transcriptional regulator | - |
M9A05_RS13540 (M9A05_13540) | 2933080..2933766 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M9A05_RS13545 (M9A05_13545) | 2933815..2935164 | - | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245615 WP_003083773.1 NZ_CP097575:2930133-2930414 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|