Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1816995..1817603 | Replicon | chromosome |
Accession | NZ_CP097575 | ||
Organism | Pseudomonas aeruginosa strain UNC_PaerCF25 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | M9A05_RS08355 | Protein ID | WP_003114156.1 |
Coordinates | 1816995..1817342 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | M9A05_RS08360 | Protein ID | WP_003114155.1 |
Coordinates | 1817352..1817603 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9A05_RS08325 (M9A05_08325) | 1812416..1812628 | + | 213 | WP_003098360.1 | cysteine-rich CWC family protein | - |
M9A05_RS08330 (M9A05_08330) | 1812628..1813320 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
M9A05_RS08335 (M9A05_08335) | 1813456..1814499 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
M9A05_RS08340 (M9A05_08340) | 1814579..1815316 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
M9A05_RS08345 (M9A05_08345) | 1815768..1816670 | + | 903 | WP_003098365.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
M9A05_RS08355 (M9A05_08355) | 1816995..1817342 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9A05_RS08360 (M9A05_08360) | 1817352..1817603 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M9A05_RS08365 (M9A05_08365) | 1817817..1818800 | - | 984 | WP_250177694.1 | tyrosine-type recombinase/integrase | - |
M9A05_RS08370 (M9A05_08370) | 1818800..1820092 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
M9A05_RS08375 (M9A05_08375) | 1820322..1821596 | - | 1275 | WP_250177695.1 | zonular occludens toxin family protein | - |
M9A05_RS08380 (M9A05_08380) | 1821600..1821956 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 1816995..1839725 | 22730 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T245613 WP_003114156.1 NZ_CP097575:c1817342-1816995 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |