Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3964181..3964838 | Replicon | chromosome |
| Accession | NZ_CP097572 | ||
| Organism | Enterobacter kobei strain C210239 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2W0G6Z0 |
| Locus tag | M8978_RS18870 | Protein ID | WP_014885136.1 |
| Coordinates | 3964181..3964591 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | M8978_RS18875 | Protein ID | WP_010435322.1 |
| Coordinates | 3964572..3964838 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8978_RS18850 (M8978_18850) | 3960175..3961908 | - | 1734 | WP_023331239.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M8978_RS18855 (M8978_18855) | 3961914..3962627 | - | 714 | WP_045134112.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M8978_RS18860 (M8978_18860) | 3962656..3963552 | - | 897 | WP_014885134.1 | site-specific tyrosine recombinase XerD | - |
| M8978_RS18865 (M8978_18865) | 3963654..3964175 | + | 522 | WP_014885135.1 | flavodoxin FldB | - |
| M8978_RS18870 (M8978_18870) | 3964181..3964591 | - | 411 | WP_014885136.1 | protein YgfX | Toxin |
| M8978_RS18875 (M8978_18875) | 3964572..3964838 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| M8978_RS18880 (M8978_18880) | 3965133..3966113 | + | 981 | WP_045134111.1 | tRNA-modifying protein YgfZ | - |
| M8978_RS18885 (M8978_18885) | 3966198..3966857 | - | 660 | WP_023331242.1 | hemolysin III family protein | - |
| M8978_RS18890 (M8978_18890) | 3967123..3967854 | + | 732 | WP_014885139.1 | MurR/RpiR family transcriptional regulator | - |
| M8978_RS18895 (M8978_18895) | 3967971..3969404 | + | 1434 | WP_014885140.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.04 Da Isoelectric Point: 10.7510
>T245610 WP_014885136.1 NZ_CP097572:c3964591-3964181 [Enterobacter kobei]
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W0G6Z0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PWU7 |