Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1143836..1144456 | Replicon | chromosome |
Accession | NZ_CP097572 | ||
Organism | Enterobacter kobei strain C210239 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2W0G488 |
Locus tag | M8978_RS05345 | Protein ID | WP_014882802.1 |
Coordinates | 1143836..1144054 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | M8978_RS05350 | Protein ID | WP_008499288.1 |
Coordinates | 1144082..1144456 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8978_RS05315 (M8978_05315) | 1139845..1140105 | + | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
M8978_RS05320 (M8978_05320) | 1140108..1140248 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
M8978_RS05325 (M8978_05325) | 1140245..1140955 | - | 711 | WP_045134726.1 | GNAT family protein | - |
M8978_RS05330 (M8978_05330) | 1141057..1142517 | + | 1461 | WP_045134727.1 | PLP-dependent aminotransferase family protein | - |
M8978_RS05335 (M8978_05335) | 1142489..1142956 | - | 468 | WP_014882800.1 | YlaC family protein | - |
M8978_RS05340 (M8978_05340) | 1143075..1143626 | - | 552 | WP_014882801.1 | maltose O-acetyltransferase | - |
M8978_RS05345 (M8978_05345) | 1143836..1144054 | - | 219 | WP_014882802.1 | HHA domain-containing protein | Toxin |
M8978_RS05350 (M8978_05350) | 1144082..1144456 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
M8978_RS05355 (M8978_05355) | 1144968..1148114 | - | 3147 | WP_014882803.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M8978_RS05360 (M8978_05360) | 1148137..1149330 | - | 1194 | WP_014882804.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T245603 WP_014882802.1 NZ_CP097572:c1144054-1143836 [Enterobacter kobei]
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT245603 WP_008499288.1 NZ_CP097572:c1144456-1144082 [Enterobacter kobei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W0G488 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |