Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 359615..360401 Replicon chromosome
Accession NZ_CP097572
Organism Enterobacter kobei strain C210239

Toxin (Protein)


Gene name yeeV Uniprot ID R8WN26
Locus tag M8978_RS01695 Protein ID WP_016154457.1
Coordinates 359615..359992 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A242VSK1
Locus tag M8978_RS01700 Protein ID WP_009652436.1
Coordinates 360042..360401 (-) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8978_RS01675 (M8978_01675) 357720..357956 - 237 WP_016154458.1 hypothetical protein -
M8978_RS01680 (M8978_01680) 357968..358813 - 846 Protein_322 DUF4942 domain-containing protein -
M8978_RS01685 (M8978_01685) 358894..359097 - 204 WP_009652505.1 DUF957 domain-containing protein -
M8978_RS01690 (M8978_01690) 359127..359618 - 492 WP_009652438.1 DUF5983 family protein -
M8978_RS01695 (M8978_01695) 359615..359992 - 378 WP_016154457.1 TA system toxin CbtA family protein Toxin
M8978_RS01700 (M8978_01700) 360042..360401 - 360 WP_009652436.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M8978_RS01705 (M8978_01705) 360425..360646 - 222 WP_009652392.1 DUF987 domain-containing protein -
M8978_RS01710 (M8978_01710) 360660..361142 - 483 WP_016154455.1 DNA repair protein RadC -
M8978_RS01715 (M8978_01715) 361154..361372 - 219 WP_009652503.1 hypothetical protein -
M8978_RS01720 (M8978_01720) 361383..361856 - 474 WP_009652453.1 antirestriction protein -
M8978_RS01725 (M8978_01725) 361873..362127 - 255 WP_009652519.1 hypothetical protein -
M8978_RS01730 (M8978_01730) 362127..362945 - 819 WP_009652424.1 DUF932 domain-containing protein -
M8978_RS01735 (M8978_01735) 363049..363282 - 234 WP_009652474.1 DUF905 domain-containing protein -
M8978_RS01740 (M8978_01740) 363338..363559 - 222 WP_009652443.1 hypothetical protein -
M8978_RS01745 (M8978_01745) 363642..364154 - 513 WP_009652395.1 DUF4234 domain-containing protein -
M8978_RS01750 (M8978_01750) 364203..364673 - 471 WP_009652431.1 hypothetical protein -
M8978_RS01755 (M8978_01755) 364720..365031 - 312 WP_009652410.1 hypothetical protein -
M8978_RS01760 (M8978_01760) 365044..365310 - 267 WP_009652486.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14168.19 Da        Isoelectric Point: 9.5224

>T245602 WP_016154457.1 NZ_CP097572:c359992-359615 [Enterobacter kobei]
MQTQPVPPKREVSPRPSPVAIWQRLLSHLLDRHYGLTLNDTPFGKDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
NAETQSPLLTSIDILRARKATGLMTRHSYRAVTDITTGKYREVQP

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13286.19 Da        Isoelectric Point: 6.4780

>AT245602 WP_009652436.1 NZ_CP097572:c360401-360042 [Enterobacter kobei]
MSNTIPPVNHDIAAPWWGLKRDITPCFGARLVQEGNRLHYLNDRASITGTFSDADLRHLDQAFPLLLKQLELMLLSGELN
PRHQHCVTLYAKGLICEADSLGSHGYVYLAIYPTPATTE

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R8WN26

Antitoxin

Source ID Structure
AlphaFold DB A0A242VSK1

References