Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2128545..2129074 | Replicon | chromosome |
Accession | NZ_CP097571 | ||
Organism | Staphylococcus aureus strain V40 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M8789_RS10545 | Protein ID | WP_000621175.1 |
Coordinates | 2128545..2128907 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | M8789_RS10550 | Protein ID | WP_000948331.1 |
Coordinates | 2128904..2129074 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8789_RS10525 (2125523) | 2125523..2126293 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
M8789_RS10530 (2126268) | 2126268..2126747 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
M8789_RS10535 (2126749) | 2126749..2127075 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
M8789_RS10540 (2127194) | 2127194..2128195 | - | 1002 | WP_250164304.1 | PP2C family protein-serine/threonine phosphatase | - |
M8789_RS10545 (2128545) | 2128545..2128907 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M8789_RS10550 (2128904) | 2128904..2129074 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M8789_RS10555 (2129159) | 2129159..2130307 | - | 1149 | WP_001281160.1 | alanine racemase | - |
M8789_RS10560 (2130373) | 2130373..2130732 | - | 360 | WP_000581198.1 | holo-ACP synthase | - |
M8789_RS10565 (2130736) | 2130736..2131227 | - | 492 | WP_001205919.1 | PH domain-containing protein | - |
M8789_RS10570 (2131214) | 2131214..2132797 | - | 1584 | WP_001294651.1 | PH domain-containing protein | - |
M8789_RS10575 (2132790) | 2132790..2133269 | - | 480 | WP_001287083.1 | hypothetical protein | - |
M8789_RS10580 (2133478) | 2133478..2134038 | - | 561 | WP_001092403.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T245595 WP_000621175.1 NZ_CP097571:c2128907-2128545 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|