Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 808202..808679 Replicon chromosome
Accession NZ_CP097571
Organism Staphylococcus aureus strain V40

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag M8789_RS03740 Protein ID WP_000052076.1
Coordinates 808202..808390 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag M8789_RS03745 Protein ID WP_001059690.1
Coordinates 808419..808679 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8789_RS03710 (804191) 804191..804712 + 522 WP_000824476.1 hypothetical protein -
M8789_RS03715 (805053) 805053..805739 + 687 WP_000141556.1 thermonuclease family protein -
M8789_RS03720 (806096) 806096..806296 + 201 WP_001059082.1 cold-shock protein -
M8789_RS03725 (806793) 806793..807011 - 219 WP_000005883.1 hypothetical protein -
M8789_RS03730 (807073) 807073..807357 - 285 WP_001004397.1 hypothetical protein -
M8789_RS03735 (807445) 807445..808014 - 570 WP_001106648.1 lipoprotein N-acylation protein LnsA -
M8789_RS03740 (808202) 808202..808390 - 189 WP_000052076.1 hypothetical protein Toxin
M8789_RS03745 (808419) 808419..808679 - 261 WP_001059690.1 hypothetical protein Antitoxin
M8789_RS03750 (809020) 809020..809223 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
M8789_RS03755 (809220) 809220..809456 - 237 WP_000368687.1 hypothetical protein -
M8789_RS03760 (809681) 809681..810262 + 582 WP_001140696.1 histidine phosphatase family protein -
M8789_RS03765 (810335) 810335..810952 - 618 WP_000255565.1 LysE/ArgO family amino acid transporter -
M8789_RS03770 (811108) 811108..811602 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
M8789_RS03775 (812001) 812001..812423 - 423 WP_000974462.1 organic hydroperoxide resistance protein -
M8789_RS03780 (812571) 812571..813287 + 717 WP_000150032.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T245589 WP_000052076.1 NZ_CP097571:c808390-808202 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT245589 WP_001059690.1 NZ_CP097571:c808679-808419 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References