Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 531276..531769 | Replicon | chromosome |
Accession | NZ_CP097561 | ||
Organism | Ligilactobacillus murinus ASF361 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829DKF8 |
Locus tag | C822_RS02905 | Protein ID | WP_004047837.1 |
Coordinates | 531494..531769 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A829DFA4 |
Locus tag | C822_RS02900 | Protein ID | WP_004047835.1 |
Coordinates | 531276..531497 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C822_RS02890 (C822_000586) | 528379..529764 | - | 1386 | WP_004047832.1 | L,D-transpeptidase family protein | - |
C822_RS02895 (C822_000587) | 529921..531093 | + | 1173 | WP_004047661.1 | IS256 family transposase | - |
C822_RS02900 (C822_000588) | 531276..531497 | + | 222 | WP_004047835.1 | DUF6290 family protein | Antitoxin |
C822_RS02905 (C822_000589) | 531494..531769 | + | 276 | WP_004047837.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
C822_RS02910 | 532032..532763 | - | 732 | Protein_581 | 5'-nucleotidase, lipoprotein e(P4) family | - |
C822_RS02915 (C822_000592) | 532964..533257 | + | 294 | WP_004047845.1 | hypothetical protein | - |
C822_RS02920 (C822_000593) | 533352..533954 | + | 603 | WP_039936077.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
C822_RS02925 (C822_000594) | 534019..534546 | + | 528 | WP_004049359.1 | helix-turn-helix domain-containing protein | - |
C822_RS02930 (C822_000595) | 534531..535406 | + | 876 | WP_286011503.1 | IS3 family transposase | - |
C822_RS02935 (C822_000596) | 535503..536375 | + | 873 | WP_004047853.1 | aldose 1-epimerase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 488781..558846 | 70065 | |
- | flank | IS/Tn | - | - | 529921..531093 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10984.72 Da Isoelectric Point: 10.2588
>T245588 WP_004047837.1 NZ_CP097561:531494-531769 [Ligilactobacillus murinus ASF361]
MKEYHVEYSKRAQKQIKKLDRQIQRLLFAWIDKNLEGVSDPRIHGKGLTGNHAREWRYRIGDYRLICDIQDDIMIILALE
FGHRRSVYNKK
MKEYHVEYSKRAQKQIKKLDRQIQRLLFAWIDKNLEGVSDPRIHGKGLTGNHAREWRYRIGDYRLICDIQDDIMIILALE
FGHRRSVYNKK
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829DKF8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829DFA4 |