Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5995737..5996323 | Replicon | chromosome |
| Accession | NZ_CP097560 | ||
| Organism | Pseudomonas aeruginosa strain C4.2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | PAC42_RS28810 | Protein ID | WP_003120987.1 |
| Coordinates | 5996024..5996323 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PAC42_RS28805 | Protein ID | WP_003448662.1 |
| Coordinates | 5995737..5996027 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAC42_RS28785 (PAC42_28710) | 5990888..5991097 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| PAC42_RS28790 (PAC42_28715) | 5991319..5993208 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
| PAC42_RS28795 (PAC42_28720) | 5993205..5995181 | + | 1977 | WP_268173976.1 | DEAD/DEAH box helicase | - |
| PAC42_RS28800 (PAC42_28725) | 5995322..5995666 | + | 345 | WP_016851612.1 | hypothetical protein | - |
| PAC42_RS28805 (PAC42_28730) | 5995737..5996027 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| PAC42_RS28810 (PAC42_28735) | 5996024..5996323 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PAC42_RS28815 (PAC42_28740) | 5996525..5997649 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
| PAC42_RS28820 (PAC42_28745) | 5997649..5999358 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
| PAC42_RS28825 (PAC42_28750) | 5999362..6000687 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| PAC42_RS28830 (PAC42_28755) | 6000677..6001210 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5968758..6067139 | 98381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T245586 WP_003120987.1 NZ_CP097560:c5996323-5996024 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|