Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142484..142989 | Replicon | chromosome |
Accession | NZ_CP097560 | ||
Organism | Pseudomonas aeruginosa strain C4.2 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PAC42_RS00660 | Protein ID | WP_003083773.1 |
Coordinates | 142484..142765 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PAC42_RS00665 | Protein ID | WP_003083775.1 |
Coordinates | 142762..142989 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAC42_RS00635 (PAC42_00635) | 137735..139084 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PAC42_RS00640 (PAC42_00640) | 139133..139819 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PAC42_RS00645 (PAC42_00645) | 139920..140654 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PAC42_RS00650 (PAC42_00650) | 140834..141244 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
PAC42_RS00655 (PAC42_00655) | 141276..142184 | - | 909 | WP_057386940.1 | LysR family transcriptional regulator | - |
PAC42_RS00660 (PAC42_00660) | 142484..142765 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PAC42_RS00665 (PAC42_00665) | 142762..142989 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PAC42_RS00670 (PAC42_00670) | 143165..143785 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PAC42_RS00675 (PAC42_00675) | 143886..144386 | + | 501 | WP_057386938.1 | LEA type 2 family protein | - |
PAC42_RS00680 (PAC42_00680) | 144459..144800 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PAC42_RS00685 (PAC42_00685) | 144882..146309 | - | 1428 | WP_003083784.1 | GABA permease | - |
PAC42_RS00690 (PAC42_00690) | 146478..147971 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245582 WP_003083773.1 NZ_CP097560:c142765-142484 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|