Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 1120106..1120799 | Replicon | chromosome |
| Accession | NZ_CP097557 | ||
| Organism | Pseudomonas aeruginosa strain C1.3 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | PAC13_RS05450 | Protein ID | WP_003151133.1 |
| Coordinates | 1120106..1120483 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | PAC13_RS05455 | Protein ID | WP_001172026.1 |
| Coordinates | 1120464..1120799 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAC13_RS05440 (PAC13_05435) | 1116299..1119328 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
| PAC13_RS05445 (PAC13_05440) | 1119312..1119914 | - | 603 | WP_010465829.1 | recombinase family protein | - |
| PAC13_RS05450 (PAC13_05445) | 1120106..1120483 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PAC13_RS05455 (PAC13_05450) | 1120464..1120799 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PAC13_RS05460 (PAC13_05455) | 1120814..1121149 | + | 336 | WP_000741275.1 | hypothetical protein | - |
| PAC13_RS05465 (PAC13_05460) | 1121173..1121499 | + | 327 | WP_000091614.1 | hypothetical protein | - |
| PAC13_RS05470 (PAC13_05465) | 1121496..1121867 | + | 372 | WP_023103794.1 | hypothetical protein | - |
| PAC13_RS05475 | 1121970..1122095 | + | 126 | WP_256675080.1 | hypothetical protein | - |
| PAC13_RS05480 (PAC13_05470) | 1122092..1122772 | + | 681 | WP_049267373.1 | hypothetical protein | - |
| PAC13_RS05485 (PAC13_05475) | 1122796..1123770 | - | 975 | WP_042853537.1 | SGNH/GDSL hydrolase family protein | - |
| PAC13_RS05490 (PAC13_05480) | 1123939..1124406 | - | 468 | WP_042853536.1 | hypothetical protein | - |
| PAC13_RS05495 (PAC13_05485) | 1124488..1125057 | - | 570 | WP_023121486.1 | LemA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | aph(3')-IIb / blaPAO | mucE | 805694..1356337 | 550643 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T245576 WP_003151133.1 NZ_CP097557:1120106-1120483 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |