Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 149181..149686 | Replicon | chromosome |
| Accession | NZ_CP097557 | ||
| Organism | Pseudomonas aeruginosa strain C1.3 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PAC13_RS00695 | Protein ID | WP_003083773.1 |
| Coordinates | 149181..149462 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PAC13_RS00700 | Protein ID | WP_003083775.1 |
| Coordinates | 149459..149686 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PAC13_RS00670 (PAC13_00670) | 144432..145781 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| PAC13_RS00675 (PAC13_00675) | 145830..146516 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PAC13_RS00680 (PAC13_00680) | 146617..147351 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
| PAC13_RS00685 (PAC13_00685) | 147531..147941 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| PAC13_RS00690 (PAC13_00690) | 147973..148881 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PAC13_RS00695 (PAC13_00695) | 149181..149462 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PAC13_RS00700 (PAC13_00700) | 149459..149686 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PAC13_RS00705 (PAC13_00705) | 149862..150482 | - | 621 | WP_023092259.1 | hypothetical protein | - |
| PAC13_RS00710 (PAC13_00710) | 150583..151083 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PAC13_RS00715 (PAC13_00715) | 151156..151497 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PAC13_RS00720 (PAC13_00720) | 151579..153006 | - | 1428 | WP_023092260.1 | GABA permease | - |
| PAC13_RS00725 (PAC13_00725) | 153175..154668 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245575 WP_003083773.1 NZ_CP097557:c149462-149181 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|