Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 143248..143753 | Replicon | chromosome |
Accession | NZ_CP097556 | ||
Organism | Pseudomonas aeruginosa strain B2.1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M8Z96_RS00665 | Protein ID | WP_003083773.1 |
Coordinates | 143248..143529 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M8Z96_RS00670 | Protein ID | WP_003083775.1 |
Coordinates | 143526..143753 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Z96_RS00640 (M8Z96_00640) | 138499..139848 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
M8Z96_RS00645 (M8Z96_00645) | 139897..140583 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M8Z96_RS00650 (M8Z96_00650) | 140684..141418 | + | 735 | WP_043089546.1 | GntR family transcriptional regulator | - |
M8Z96_RS00655 (M8Z96_00655) | 141598..142008 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
M8Z96_RS00660 (M8Z96_00660) | 142040..142948 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M8Z96_RS00665 (M8Z96_00665) | 143248..143529 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M8Z96_RS00670 (M8Z96_00670) | 143526..143753 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M8Z96_RS00675 (M8Z96_00675) | 143929..144549 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M8Z96_RS00680 (M8Z96_00680) | 144650..145150 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
M8Z96_RS00685 (M8Z96_00685) | 145223..145564 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M8Z96_RS00690 (M8Z96_00690) | 145646..147073 | - | 1428 | WP_003083784.1 | GABA permease | - |
M8Z96_RS00695 (M8Z96_00695) | 147242..148735 | - | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245570 WP_003083773.1 NZ_CP097556:c143529-143248 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|