Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5294676..5295252 | Replicon | chromosome |
| Accession | NZ_CP097554 | ||
| Organism | Klebsiella michiganensis strain YZUMF202001 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A1D8JNH2 |
| Locus tag | M8333_RS24925 | Protein ID | WP_042933975.1 |
| Coordinates | 5294965..5295252 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A1D8JNF7 |
| Locus tag | M8333_RS24920 | Protein ID | WP_025108476.1 |
| Coordinates | 5294676..5294978 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8333_RS24905 (M8333_24900) | 5291515..5291850 | + | 336 | WP_047724615.1 | endoribonuclease SymE | - |
| M8333_RS24910 (M8333_24905) | 5292304..5293215 | + | 912 | WP_128696653.1 | acetamidase/formamidase family protein | - |
| M8333_RS24915 (M8333_24910) | 5293212..5294555 | + | 1344 | WP_025108477.1 | APC family permease | - |
| M8333_RS24920 (M8333_24915) | 5294676..5294978 | - | 303 | WP_025108476.1 | BrnA antitoxin family protein | Antitoxin |
| M8333_RS24925 (M8333_24920) | 5294965..5295252 | - | 288 | WP_042933975.1 | BrnT family toxin | Toxin |
| M8333_RS24930 (M8333_24925) | 5295504..5295947 | - | 444 | WP_025108475.1 | FosA family fosfomycin resistance glutathione transferase | - |
| M8333_RS24935 (M8333_24930) | 5295941..5296849 | - | 909 | WP_025108474.1 | LysR family transcriptional regulator | - |
| M8333_RS24940 (M8333_24935) | 5296937..5297719 | + | 783 | WP_025108473.1 | NAD(P)H-dependent oxidoreductase | - |
| M8333_RS24945 (M8333_24940) | 5297867..5298451 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| M8333_RS24950 (M8333_24945) | 5298597..5299397 | + | 801 | WP_014227752.1 | winged helix-turn-helix domain-containing protein | - |
| M8333_RS24955 (M8333_24950) | 5299394..5299912 | + | 519 | WP_004098240.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11239.69 Da Isoelectric Point: 8.5899
>T245563 WP_042933975.1 NZ_CP097554:c5295252-5294965 [Klebsiella michiganensis]
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8JNH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8JNF7 |