Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4614147..4614766 | Replicon | chromosome |
| Accession | NZ_CP097554 | ||
| Organism | Klebsiella michiganensis strain YZUMF202001 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | M8333_RS21775 | Protein ID | WP_004099646.1 |
| Coordinates | 4614548..4614766 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0J2I7Z1 |
| Locus tag | M8333_RS21770 | Protein ID | WP_025107145.1 |
| Coordinates | 4614147..4614521 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8333_RS21760 (M8333_21760) | 4609304..4610497 | + | 1194 | WP_004136054.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M8333_RS21765 (M8333_21765) | 4610520..4613666 | + | 3147 | WP_014228207.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M8333_RS21770 (M8333_21770) | 4614147..4614521 | + | 375 | WP_025107145.1 | Hha toxicity modulator TomB | Antitoxin |
| M8333_RS21775 (M8333_21775) | 4614548..4614766 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| M8333_RS21780 (M8333_21780) | 4614929..4615495 | + | 567 | WP_064357999.1 | maltose O-acetyltransferase | - |
| M8333_RS21785 (M8333_21785) | 4615467..4615601 | - | 135 | WP_223226764.1 | hypothetical protein | - |
| M8333_RS21790 (M8333_21790) | 4615622..4616092 | + | 471 | WP_014228205.1 | YlaC family protein | - |
| M8333_RS21795 (M8333_21795) | 4616067..4617521 | - | 1455 | WP_116280241.1 | PLP-dependent aminotransferase family protein | - |
| M8333_RS21800 (M8333_21800) | 4617623..4618321 | + | 699 | WP_048261453.1 | GNAT family protein | - |
| M8333_RS21805 (M8333_21805) | 4618318..4618458 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| M8333_RS21810 (M8333_21810) | 4618458..4618721 | - | 264 | WP_004848323.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T245561 WP_004099646.1 NZ_CP097554:4614548-4614766 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14366.15 Da Isoelectric Point: 4.8989
>AT245561 WP_025107145.1 NZ_CP097554:4614147-4614521 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2I7Z1 |