Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4614147..4614766 Replicon chromosome
Accession NZ_CP097554
Organism Klebsiella michiganensis strain YZUMF202001

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag M8333_RS21775 Protein ID WP_004099646.1
Coordinates 4614548..4614766 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0J2I7Z1
Locus tag M8333_RS21770 Protein ID WP_025107145.1
Coordinates 4614147..4614521 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8333_RS21760 (M8333_21760) 4609304..4610497 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M8333_RS21765 (M8333_21765) 4610520..4613666 + 3147 WP_014228207.1 multidrug efflux RND transporter permease subunit AcrB -
M8333_RS21770 (M8333_21770) 4614147..4614521 + 375 WP_025107145.1 Hha toxicity modulator TomB Antitoxin
M8333_RS21775 (M8333_21775) 4614548..4614766 + 219 WP_004099646.1 HHA domain-containing protein Toxin
M8333_RS21780 (M8333_21780) 4614929..4615495 + 567 WP_064357999.1 maltose O-acetyltransferase -
M8333_RS21785 (M8333_21785) 4615467..4615601 - 135 WP_223226764.1 hypothetical protein -
M8333_RS21790 (M8333_21790) 4615622..4616092 + 471 WP_014228205.1 YlaC family protein -
M8333_RS21795 (M8333_21795) 4616067..4617521 - 1455 WP_116280241.1 PLP-dependent aminotransferase family protein -
M8333_RS21800 (M8333_21800) 4617623..4618321 + 699 WP_048261453.1 GNAT family protein -
M8333_RS21805 (M8333_21805) 4618318..4618458 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
M8333_RS21810 (M8333_21810) 4618458..4618721 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-115)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T245561 WP_004099646.1 NZ_CP097554:4614548-4614766 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14366.15 Da        Isoelectric Point: 4.8989

>AT245561 WP_025107145.1 NZ_CP097554:4614147-4614521 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNACRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0J2I7Z1

References