Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2094328..2094918 | Replicon | chromosome |
Accession | NZ_CP097554 | ||
Organism | Klebsiella michiganensis strain YZUMF202001 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0H3HDW1 |
Locus tag | M8333_RS09955 | Protein ID | WP_014229979.1 |
Coordinates | 2094586..2094918 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | J6I3K7 |
Locus tag | M8333_RS09950 | Protein ID | WP_004852307.1 |
Coordinates | 2094328..2094585 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8333_RS09925 (M8333_09930) | 2089585..2090190 | - | 606 | WP_004852315.1 | glutathione S-transferase family protein | - |
M8333_RS09930 (M8333_09935) | 2090370..2091296 | + | 927 | WP_049101399.1 | LysR substrate-binding domain-containing protein | - |
M8333_RS09935 (M8333_09940) | 2091334..2092332 | - | 999 | WP_025106069.1 | aldo/keto reductase | - |
M8333_RS09940 (M8333_09945) | 2092433..2093347 | + | 915 | WP_025106070.1 | LysR family transcriptional regulator | - |
M8333_RS09945 (M8333_09950) | 2093466..2093735 | - | 270 | WP_185220221.1 | hypothetical protein | - |
M8333_RS09950 (M8333_09955) | 2094328..2094585 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
M8333_RS09955 (M8333_09960) | 2094586..2094918 | + | 333 | WP_014229979.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M8333_RS09965 (M8333_09970) | 2095241..2096698 | + | 1458 | WP_128334953.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
M8333_RS09975 (M8333_09980) | 2097661..2099115 | - | 1455 | WP_014229909.1 | AMP nucleosidase | - |
M8333_RS09980 (M8333_09985) | 2099248..2099505 | - | 258 | WP_014229908.1 | histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2084623..2094918 | 10295 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11740.57 Da Isoelectric Point: 10.1863
>T245556 WP_014229979.1 NZ_CP097554:2094586-2094918 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVSLEGAGTKTTGVIRCDQPRTI
DMAARNGKRLESIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3HDW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3HDW8 |