Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 663717..664309 | Replicon | chromosome |
Accession | NZ_CP097554 | ||
Organism | Klebsiella michiganensis strain YZUMF202001 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A7H4PHG5 |
Locus tag | M8333_RS03215 | Protein ID | WP_004105955.1 |
Coordinates | 663935..664309 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A2J4YM08 |
Locus tag | M8333_RS03210 | Protein ID | WP_004105957.1 |
Coordinates | 663717..663938 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8333_RS03190 (M8333_03195) | 659274..659828 | + | 555 | WP_014226934.1 | YgjV family protein | - |
M8333_RS03195 (M8333_03200) | 659847..661094 | - | 1248 | WP_004105963.1 | serine/threonine transporter SstT | - |
M8333_RS03200 (M8333_03205) | 661349..662317 | - | 969 | WP_048260487.1 | TerC family protein | - |
M8333_RS03205 (M8333_03210) | 662568..663557 | - | 990 | WP_057173194.1 | Gfo/Idh/MocA family oxidoreductase | - |
M8333_RS03210 (M8333_03215) | 663717..663938 | + | 222 | WP_004105957.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M8333_RS03215 (M8333_03220) | 663935..664309 | + | 375 | WP_004105955.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M8333_RS03220 (M8333_03225) | 664289..664792 | - | 504 | WP_004105953.1 | M48 family metallopeptidase | - |
M8333_RS03225 (M8333_03230) | 664871..666514 | - | 1644 | WP_224266337.1 | glycoside hydrolase family 43 protein | - |
M8333_RS03230 (M8333_03235) | 666643..667509 | - | 867 | WP_224266338.1 | AraC family transcriptional regulator | - |
M8333_RS03235 (M8333_03240) | 667617..668960 | + | 1344 | WP_025108308.1 | glycoside-pentoside-hexuronide (GPH):cation symporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13895.93 Da Isoelectric Point: 6.0769
>T245553 WP_004105955.1 NZ_CP097554:663935-664309 [Klebsiella michiganensis]
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
MKWVSASEVIAFHDRILQHLPGVKGMSDPGRAEAIIYRVQNRFHYEGVNDIFELAATYWVAIARGHIFNDGNKRTAFFIT
MTFLARNGYLIADEDTRLEELTVLAATGEATVVVLADALRQLAL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7H4PHG5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4YM08 |