Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 65245..65792 | Replicon | chromosome |
Accession | NZ_CP097554 | ||
Organism | Klebsiella michiganensis strain YZUMF202001 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | M8333_RS00320 | Protein ID | WP_122116989.1 |
Coordinates | 65245..65553 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A0H3H0P7 |
Locus tag | M8333_RS00325 | Protein ID | WP_014227298.1 |
Coordinates | 65556..65792 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8333_RS00295 (M8333_00295) | 61161..61472 | - | 312 | WP_014227304.1 | PTS sugar transporter subunit IIB | - |
M8333_RS00300 (M8333_00300) | 61767..62708 | + | 942 | WP_014227303.1 | LacI family DNA-binding transcriptional regulator | - |
M8333_RS00305 (M8333_00305) | 62732..63025 | - | 294 | WP_014227302.1 | YicS family protein | - |
M8333_RS00310 (M8333_00310) | 63235..64188 | + | 954 | WP_116280588.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
M8333_RS00315 (M8333_00315) | 64192..65094 | - | 903 | WP_009654083.1 | DMT family transporter | - |
M8333_RS00320 (M8333_00320) | 65245..65553 | - | 309 | WP_122116989.1 | CcdB family protein | Toxin |
M8333_RS00325 (M8333_00325) | 65556..65792 | - | 237 | WP_014227298.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
M8333_RS00330 (M8333_00330) | 65898..67331 | - | 1434 | WP_032718833.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
M8333_RS00335 (M8333_00335) | 67356..68258 | - | 903 | WP_032752002.1 | N-acetylmuramic acid 6-phosphate etherase | - |
M8333_RS00340 (M8333_00340) | 68419..69585 | - | 1167 | WP_014227296.1 | multidrug effflux MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11706.52 Da Isoelectric Point: 6.8684
>T245552 WP_122116989.1 NZ_CP097554:c65553-65245 [Klebsiella michiganensis]
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHHVLGEE
VCNLNHQREVVKASMDFLFDGI
MQYYVYKNTGRIAAYPYLLDVQSDIIGKRNTRVVIPLFPLKNYKGPRADRLTPLVTVEGEEYVVMTHELASIPHHVLGEE
VCNLNHQREVVKASMDFLFDGI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|