Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 91605..92217 | Replicon | plasmid pDFL36-03 |
Accession | NZ_CP097550 | ||
Organism | Dinoroseobacter shibae strain DFL-36 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A840CKU8 |
Locus tag | M8007_RS20665 | Protein ID | WP_012187367.1 |
Coordinates | 91822..92217 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M8007_RS20660 | Protein ID | WP_012187366.1 |
Coordinates | 91605..91832 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8007_RS20645 (M8007_20645) | 87678..88913 | - | 1236 | WP_012187363.1 | plasmid replication protein RepC | - |
M8007_RS20650 (M8007_20650) | 89091..90107 | - | 1017 | WP_012187364.1 | plasmid partitioning protein RepB | - |
M8007_RS20655 (M8007_20655) | 90104..91291 | - | 1188 | WP_012187365.1 | plasmid partitioning protein RepA | - |
M8007_RS20660 (M8007_20660) | 91605..91832 | + | 228 | WP_012187366.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M8007_RS20665 (M8007_20665) | 91822..92217 | + | 396 | WP_012187367.1 | PIN domain-containing protein | Toxin |
M8007_RS20670 (M8007_20670) | 92201..93097 | - | 897 | WP_012187368.1 | recombinase family protein | - |
M8007_RS20675 (M8007_20675) | 93156..94274 | - | 1119 | WP_012187369.1 | tyrosine-type recombinase/integrase | - |
M8007_RS20680 (M8007_20680) | 94401..95285 | + | 885 | WP_249994546.1 | DUF1403 family protein | - |
M8007_RS20685 (M8007_20685) | 95288..95905 | + | 618 | WP_012187055.1 | SMC-Scp complex subunit ScpB | - |
M8007_RS20690 (M8007_20690) | 95955..96218 | + | 264 | WP_012187054.1 | WGR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..126307 | 126307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14296.32 Da Isoelectric Point: 4.2692
>T245551 WP_012187367.1 NZ_CP097550:91822-92217 [Dinoroseobacter shibae]
MSAEFADTNVVLYLLDDGPKAERAEEILGQGPRISVQVLNEAMVNCRRKAGLSWEDTGAFLEGITSVCPVEGLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDMHDGLLVEDRLRIVNPFA
MSAEFADTNVVLYLLDDGPKAERAEEILGQGPRISVQVLNEAMVNCRRKAGLSWEDTGAFLEGITSVCPVEGLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDMHDGLLVEDRLRIVNPFA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|