Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 67147..67688 | Replicon | plasmid pDFL36-01 |
Accession | NZ_CP097548 | ||
Organism | Dinoroseobacter shibae strain DFL-36 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M8007_RS18830 | Protein ID | WP_044029371.1 |
Coordinates | 67362..67688 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M8007_RS18825 | Protein ID | WP_012187139.1 |
Coordinates | 67147..67365 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8007_RS18810 (M8007_18810) | 63298..64170 | + | 873 | WP_012187142.1 | site-specific integrase | - |
M8007_RS18815 (M8007_18815) | 64183..65385 | + | 1203 | WP_012187141.1 | IS91 family transposase | - |
M8007_RS18820 (M8007_18820) | 65753..67048 | - | 1296 | WP_050757916.1 | DUF4010 domain-containing protein | - |
M8007_RS18825 (M8007_18825) | 67147..67365 | + | 219 | WP_012187139.1 | antitoxin MazE family protein | Antitoxin |
M8007_RS18830 (M8007_18830) | 67362..67688 | + | 327 | WP_044029371.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M8007_RS18835 (M8007_18835) | 67856..68140 | - | 285 | WP_157865439.1 | DUF4258 domain-containing protein | - |
M8007_RS18840 (M8007_18840) | 68445..68645 | - | 201 | WP_044029373.1 | hypothetical protein | - |
M8007_RS18845 (M8007_18845) | 68732..69094 | - | 363 | WP_012187136.1 | zf-TFIIB domain-containing protein | - |
M8007_RS18850 (M8007_18850) | 69101..69835 | - | 735 | WP_012187135.1 | Bax inhibitor-1/YccA family protein | - |
M8007_RS18855 (M8007_18855) | 70079..70765 | - | 687 | WP_157865440.1 | exopolysaccharide biosynthesis protein | - |
M8007_RS18860 (M8007_18860) | 70773..71738 | - | 966 | WP_012187133.1 | calcium/sodium antiporter | - |
M8007_RS18865 (M8007_18865) | 71864..72325 | - | 462 | WP_012187132.1 | pentapeptide repeat-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..190506 | 190506 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11657.55 Da Isoelectric Point: 7.2042
>T245550 WP_044029371.1 NZ_CP097548:67362-67688 [Dinoroseobacter shibae]
MRRGELVTVALQGDHGKPHPALVIQSDRFPDTATTTILMVTSTLVNAPLIRLTVEPASENGLRATSQIMIDKAMTVRTDK
LRGAFGQLDDTVMLEVNRALALFLGVTG
MRRGELVTVALQGDHGKPHPALVIQSDRFPDTATTTILMVTSTLVNAPLIRLTVEPASENGLRATSQIMIDKAMTVRTDK
LRGAFGQLDDTVMLEVNRALALFLGVTG
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|