Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 91602..92214 | Replicon | plasmid pDSHI03 |
Accession | NZ_CP097543 | ||
Organism | Dinoroseobacter shibae strain DSM 112351 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A840CKU8 |
Locus tag | M8008_RS20640 | Protein ID | WP_012187367.1 |
Coordinates | 91819..92214 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M8008_RS20635 | Protein ID | WP_012187366.1 |
Coordinates | 91602..91829 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8008_RS20620 (M8008_20620) | 87675..88910 | - | 1236 | WP_012187363.1 | plasmid replication protein RepC | - |
M8008_RS20625 (M8008_20625) | 89088..90104 | - | 1017 | WP_012187364.1 | plasmid partitioning protein RepB | - |
M8008_RS20630 (M8008_20630) | 90101..91288 | - | 1188 | WP_012187365.1 | plasmid partitioning protein RepA | - |
M8008_RS20635 (M8008_20635) | 91602..91829 | + | 228 | WP_012187366.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M8008_RS20640 (M8008_20640) | 91819..92214 | + | 396 | WP_012187367.1 | PIN domain-containing protein | Toxin |
M8008_RS20645 (M8008_20645) | 92198..93094 | - | 897 | WP_012187368.1 | recombinase family protein | - |
M8008_RS20650 (M8008_20650) | 93153..94271 | - | 1119 | WP_012187369.1 | tyrosine-type recombinase/integrase | - |
M8008_RS20655 (M8008_20655) | 94398..95282 | + | 885 | WP_012187056.1 | DUF1403 family protein | - |
M8008_RS20660 (M8008_20660) | 95285..95902 | + | 618 | WP_012187055.1 | SMC-Scp complex subunit ScpB | - |
M8008_RS20665 (M8008_20665) | 95952..96215 | + | 264 | WP_012187054.1 | WGR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..126304 | 126304 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14296.32 Da Isoelectric Point: 4.2692
>T245549 WP_012187367.1 NZ_CP097543:91819-92214 [Dinoroseobacter shibae]
MSAEFADTNVVLYLLDDGPKAERAEEILGQGPRISVQVLNEAMVNCRRKAGLSWEDTGAFLEGITSVCPVEGLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDMHDGLLVEDRLRIVNPFA
MSAEFADTNVVLYLLDDGPKAERAEEILGQGPRISVQVLNEAMVNCRRKAGLSWEDTGAFLEGITSVCPVEGLTVQTHQV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWTEDMHDGLLVEDRLRIVNPFA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|