Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 67147..67688 | Replicon | plasmid pDSHI01 |
| Accession | NZ_CP097541 | ||
| Organism | Dinoroseobacter shibae strain DSM 112351 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M8008_RS18805 | Protein ID | WP_044029371.1 |
| Coordinates | 67362..67688 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M8008_RS18800 | Protein ID | WP_012187139.1 |
| Coordinates | 67147..67365 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8008_RS18785 (M8008_18785) | 63298..64170 | + | 873 | WP_012187142.1 | site-specific integrase | - |
| M8008_RS18790 (M8008_18790) | 64183..65385 | + | 1203 | WP_012187141.1 | IS91 family transposase | - |
| M8008_RS18795 (M8008_18795) | 65753..67048 | - | 1296 | WP_050757916.1 | DUF4010 domain-containing protein | - |
| M8008_RS18800 (M8008_18800) | 67147..67365 | + | 219 | WP_012187139.1 | antitoxin MazE family protein | Antitoxin |
| M8008_RS18805 (M8008_18805) | 67362..67688 | + | 327 | WP_044029371.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M8008_RS18810 (M8008_18810) | 67856..68140 | - | 285 | WP_157865439.1 | DUF4258 domain-containing protein | - |
| M8008_RS18815 (M8008_18815) | 68445..68645 | - | 201 | WP_044029373.1 | hypothetical protein | - |
| M8008_RS18820 (M8008_18820) | 68732..69094 | - | 363 | WP_012187136.1 | zf-TFIIB domain-containing protein | - |
| M8008_RS18825 (M8008_18825) | 69101..69835 | - | 735 | WP_012187135.1 | Bax inhibitor-1/YccA family protein | - |
| M8008_RS18830 (M8008_18830) | 70079..70765 | - | 687 | WP_157865440.1 | exopolysaccharide biosynthesis protein | - |
| M8008_RS18835 (M8008_18835) | 70773..71738 | - | 966 | WP_012187133.1 | calcium/sodium antiporter | - |
| M8008_RS18840 (M8008_18840) | 71864..72325 | - | 462 | WP_012187132.1 | pentapeptide repeat-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..190506 | 190506 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11657.55 Da Isoelectric Point: 7.2042
>T245548 WP_044029371.1 NZ_CP097541:67362-67688 [Dinoroseobacter shibae]
MRRGELVTVALQGDHGKPHPALVIQSDRFPDTATTTILMVTSTLVNAPLIRLTVEPASENGLRATSQIMIDKAMTVRTDK
LRGAFGQLDDTVMLEVNRALALFLGVTG
MRRGELVTVALQGDHGKPHPALVIQSDRFPDTATTTILMVTSTLVNAPLIRLTVEPASENGLRATSQIMIDKAMTVRTDK
LRGAFGQLDDTVMLEVNRALALFLGVTG
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|