Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 2846703..2847256 | Replicon | chromosome |
Accession | NZ_CP097528 | ||
Organism | Pseudomonas putida strain KT2440 isolate pMBEC6 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | M8003_RS13150 | Protein ID | WP_010953434.1 |
Coordinates | 2846963..2847256 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q88JZ4 |
Locus tag | M8003_RS13145 | Protein ID | WP_010953433.1 |
Coordinates | 2846703..2846975 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8003_RS13115 (M8003_13095) | 2842275..2842634 | - | 360 | Protein_2544 | JAB domain-containing protein | - |
M8003_RS13120 (M8003_13100) | 2842606..2843556 | - | 951 | WP_031299400.1 | hypothetical protein | - |
M8003_RS13125 (M8003_13105) | 2843649..2844653 | - | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
M8003_RS13130 (M8003_13110) | 2844733..2845701 | - | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
M8003_RS13135 (M8003_13115) | 2845799..2846128 | - | 330 | WP_010953431.1 | hypothetical protein | - |
M8003_RS13140 (M8003_13120) | 2846333..2846578 | + | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M8003_RS13145 (M8003_13125) | 2846703..2846975 | + | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M8003_RS13150 (M8003_13130) | 2846963..2847256 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M8003_RS13155 (M8003_13135) | 2847250..2848659 | - | 1410 | WP_010953435.1 | site-specific integrase | - |
M8003_RS13160 (M8003_13140) | 2849182..2850108 | - | 927 | WP_010953436.1 | LysR family transcriptional regulator | - |
M8003_RS13165 (M8003_13145) | 2850222..2850953 | + | 732 | WP_010953437.1 | SDR family NAD(P)-dependent oxidoreductase | - |
M8003_RS13170 (M8003_13150) | 2851023..2851232 | + | 210 | WP_010953438.1 | 4-oxalocrotonate tautomerase family protein | - |
M8003_RS13175 (M8003_13155) | 2851229..2851441 | + | 213 | WP_061405625.1 | hypothetical protein | - |
M8003_RS13180 (M8003_13160) | 2851584..2852102 | + | 519 | WP_049587643.1 | DUF1993 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T245535 WP_010953434.1 NZ_CP097528:2846963-2847256 [Pseudomonas putida]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q88JZ4 |