Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2780270..2781153 | Replicon | chromosome |
Accession | NZ_CP097528 | ||
Organism | Pseudomonas putida strain KT2440 isolate pMBEC6 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q88K57 |
Locus tag | M8003_RS12770 | Protein ID | WP_003250527.1 |
Coordinates | 2780716..2781153 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | I7C3Q7 |
Locus tag | M8003_RS12765 | Protein ID | WP_003250525.1 |
Coordinates | 2780270..2780719 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8003_RS12740 (M8003_12720) | 2775694..2776893 | + | 1200 | WP_049587621.1 | sugar transporter | - |
M8003_RS12745 (M8003_12725) | 2776933..2777517 | - | 585 | WP_010953382.1 | LysE family transporter | - |
M8003_RS12750 (M8003_12730) | 2777568..2778398 | - | 831 | WP_003250518.1 | AraC family transcriptional regulator | - |
M8003_RS12755 (M8003_12735) | 2778447..2779370 | - | 924 | WP_010953383.1 | LysR family transcriptional regulator | - |
M8003_RS12760 (M8003_12740) | 2779474..2780127 | + | 654 | WP_010953384.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
M8003_RS12765 (M8003_12745) | 2780270..2780719 | + | 450 | WP_003250525.1 | DUF2384 domain-containing protein | Antitoxin |
M8003_RS12770 (M8003_12750) | 2780716..2781153 | + | 438 | WP_003250527.1 | RES family NAD+ phosphorylase | Toxin |
M8003_RS12775 (M8003_12755) | 2781161..2782315 | - | 1155 | WP_049587669.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
M8003_RS12780 (M8003_12760) | 2782509..2783435 | - | 927 | WP_010953387.1 | LysR family transcriptional regulator | - |
M8003_RS12785 (M8003_12765) | 2783576..2784805 | + | 1230 | WP_049587623.1 | acyl-CoA dehydrogenase | - |
M8003_RS12790 (M8003_12770) | 2784969..2785217 | + | 249 | Protein_2482 | PAAR domain-containing protein | - |
M8003_RS12795 (M8003_12775) | 2785220..2785609 | + | 390 | WP_049587628.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15990.29 Da Isoelectric Point: 5.6007
>T245534 WP_003250527.1 NZ_CP097528:2780716-2781153 [Pseudomonas putida]
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
Download Length: 438 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16956.46 Da Isoelectric Point: 5.7258
>AT245534 WP_003250525.1 NZ_CP097528:2780270-2780719 [Pseudomonas putida]
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|