Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/RHH(antitoxin)
Location 2846700..2847253 Replicon chromosome
Accession NZ_CP097527
Organism Pseudomonas putida strain KT2440 isolate pnCas9-BEC6-C

Toxin (Protein)


Gene name parE Uniprot ID Q88JZ3
Locus tag M8001_RS13150 Protein ID WP_010953434.1
Coordinates 2846960..2847253 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q88JZ4
Locus tag M8001_RS13145 Protein ID WP_010953433.1
Coordinates 2846700..2846972 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8001_RS13115 (M8001_13095) 2842272..2842631 - 360 Protein_2544 JAB domain-containing protein -
M8001_RS13120 (M8001_13100) 2842603..2843553 - 951 WP_031299400.1 hypothetical protein -
M8001_RS13125 (M8001_13105) 2843646..2844650 - 1005 WP_010953429.1 YqaJ viral recombinase family protein -
M8001_RS13130 (M8001_13110) 2844730..2845698 - 969 WP_031299399.1 DUF932 domain-containing protein -
M8001_RS13135 (M8001_13115) 2845796..2846125 - 330 WP_010953431.1 hypothetical protein -
M8001_RS13140 (M8001_13120) 2846330..2846575 + 246 WP_010953432.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M8001_RS13145 (M8001_13125) 2846700..2846972 + 273 WP_010953433.1 CopG family ribbon-helix-helix protein Antitoxin
M8001_RS13150 (M8001_13130) 2846960..2847253 + 294 WP_010953434.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M8001_RS13155 (M8001_13135) 2847247..2848656 - 1410 WP_010953435.1 site-specific integrase -
M8001_RS13160 (M8001_13140) 2849179..2850105 - 927 WP_010953436.1 LysR family transcriptional regulator -
M8001_RS13165 (M8001_13145) 2850219..2850950 + 732 WP_010953437.1 SDR family NAD(P)-dependent oxidoreductase -
M8001_RS13170 (M8001_13150) 2851020..2851229 + 210 WP_010953438.1 4-oxalocrotonate tautomerase family protein -
M8001_RS13175 (M8001_13155) 2851226..2851438 + 213 WP_061405625.1 hypothetical protein -
M8001_RS13180 (M8001_13160) 2851581..2852099 + 519 WP_049587643.1 DUF1993 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-95)

Antitoxin

Ribbon-helix-helix protein, CopG

(3-40)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11155.61 Da        Isoelectric Point: 5.9081

>T245526 WP_010953434.1 NZ_CP097527:2846960-2847253 [Pseudomonas putida]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY

Download         Length: 294 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10373.53 Da        Isoelectric Point: 5.5744

>AT245526 WP_010953433.1 NZ_CP097527:2846700-2846972 [Pseudomonas putida]
MATSIKIDDDLKGRIQHLACLRQRSSHWIMREAITQYVEREEARESFKQEALASWAAYQETGQHLTGQEARTWLGSWGTD
AEAELPKCHD

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W5CNE8

Antitoxin

Source ID Structure
AlphaFold DB Q88JZ4

References