Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 332741..333732 | Replicon | chromosome |
Accession | NZ_CP097527 | ||
Organism | Pseudomonas putida strain KT2440 isolate pnCas9-BEC6-C |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M8001_RS01445 | Protein ID | WP_020190010.1 |
Coordinates | 332741..333217 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | Q88R60 |
Locus tag | M8001_RS01450 | Protein ID | WP_004575922.1 |
Coordinates | 333259..333732 (+) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8001_RS01425 (M8001_01420) | 327884..329251 | - | 1368 | WP_010951639.1 | ATP-binding protein | - |
M8001_RS01430 (M8001_01425) | 329253..329972 | - | 720 | WP_010951640.1 | response regulator | - |
M8001_RS01435 (M8001_01430) | 330113..332410 | + | 2298 | WP_010951641.1 | TonB-dependent siderophore receptor | - |
M8001_RS01440 (M8001_01435) | 332476..332682 | - | 207 | WP_014860378.1 | DUF3079 domain-containing protein | - |
M8001_RS01445 (M8001_01440) | 332741..333217 | + | 477 | WP_020190010.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M8001_RS01450 (M8001_01445) | 333259..333732 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
M8001_RS01455 (M8001_01450) | 333737..333924 | - | 188 | Protein_282 | integrase | - |
M8001_RS01460 (M8001_01455) | 334152..334367 | + | 216 | WP_010951644.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
M8001_RS01465 (M8001_01460) | 334364..334687 | - | 324 | WP_010951645.1 | helix-turn-helix transcriptional regulator | - |
M8001_RS01475 (M8001_01470) | 335149..335397 | - | 249 | WP_010951646.1 | hypothetical protein | - |
M8001_RS01480 (M8001_01475) | 335918..336193 | + | 276 | WP_049588069.1 | DUF3077 domain-containing protein | - |
M8001_RS01485 (M8001_01480) | 336548..337753 | - | 1206 | WP_010951648.1 | methyltransferase | - |
M8001_RS01490 (M8001_01485) | 337882..338571 | - | 690 | WP_010951649.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18386.38 Da Isoelectric Point: 10.3522
>T245521 WP_020190010.1 NZ_CP097527:332741-333217 [Pseudomonas putida]
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 477 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT245521 WP_004575922.1 NZ_CP097527:333259-333732 [Pseudomonas putida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|