Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1947157..1947627 Replicon chromosome
Accession NZ_CP097519
Organism Staphylococcus epidermidis strain C066

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag M8Z95_RS09150 Protein ID WP_001829569.1
Coordinates 1947439..1947627 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag M8Z95_RS09145 Protein ID WP_002438963.1
Coordinates 1947157..1947414 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Z95_RS09110 (M8Z95_09110) 1942444..1942599 - 156 WP_001829648.1 hypothetical protein -
M8Z95_RS09115 (M8Z95_09115) 1942611..1942798 - 188 Protein_1763 hypothetical protein -
M8Z95_RS09120 (M8Z95_09120) 1942949..1944148 - 1200 WP_073392450.1 IS110-like element ISSep2 family transposase -
M8Z95_RS09125 (M8Z95_09125) 1944745..1945245 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
M8Z95_RS09130 (M8Z95_09130) 1945516..1946103 - 588 WP_002469329.1 histidine phosphatase family protein -
M8Z95_RS09135 (M8Z95_09135) 1946317..1946553 + 237 WP_002457224.1 hypothetical protein -
M8Z95_RS09140 (M8Z95_09140) 1946545..1946748 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
M8Z95_RS09145 (M8Z95_09145) 1947157..1947414 + 258 WP_002438963.1 hypothetical protein Antitoxin
M8Z95_RS09150 (M8Z95_09150) 1947439..1947627 + 189 WP_001829569.1 hypothetical protein Toxin
M8Z95_RS09155 (M8Z95_09155) 1947817..1948371 + 555 WP_002469327.1 lipoprotein N-acylation protein LnsA -
M8Z95_RS09160 (M8Z95_09160) 1948431..1948664 - 234 WP_001829664.1 hypothetical protein -
M8Z95_RS09165 (M8Z95_09165) 1948948..1949694 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
M8Z95_RS09170 (M8Z95_09170) 1949793..1950077 + 285 WP_001829635.1 hypothetical protein -
M8Z95_RS09175 (M8Z95_09175) 1950101..1950325 + 225 WP_001829613.1 hypothetical protein -
M8Z95_RS09180 (M8Z95_09180) 1950946..1951146 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T245520 WP_001829569.1 NZ_CP097519:1947439-1947627 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT245520 WP_002438963.1 NZ_CP097519:1947157-1947414 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References