Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1806362..1807164 | Replicon | chromosome |
| Accession | NZ_CP097519 | ||
| Organism | Staphylococcus epidermidis strain C066 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M8Z95_RS08405 | Protein ID | WP_002469232.1 |
| Coordinates | 1806703..1807164 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M8Z95_RS08400 | Protein ID | WP_002439260.1 |
| Coordinates | 1806362..1806691 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8Z95_RS08350 (M8Z95_08350) | 1801421..1801636 | + | 216 | WP_001831694.1 | NINE protein | - |
| M8Z95_RS08355 (M8Z95_08355) | 1802179..1802709 | + | 531 | WP_002475755.1 | N-acetyltransferase | - |
| M8Z95_RS08360 (M8Z95_08360) | 1803483..1803716 | - | 234 | Protein_1613 | AAA family ATPase | - |
| M8Z95_RS08365 (M8Z95_08365) | 1804095..1804322 | + | 228 | WP_002505719.1 | DUF2188 domain-containing protein | - |
| M8Z95_RS08370 (M8Z95_08370) | 1804319..1804522 | - | 204 | WP_002505718.1 | hypothetical protein | - |
| M8Z95_RS08375 (M8Z95_08375) | 1804537..1804749 | - | 213 | Protein_1616 | DUF771 domain-containing protein | - |
| M8Z95_RS08380 (M8Z95_08380) | 1804753..1805508 | - | 756 | Protein_1617 | phage regulatory protein/antirepressor Ant | - |
| M8Z95_RS08385 (M8Z95_08385) | 1805558..1805764 | + | 207 | WP_002439266.1 | hypothetical protein | - |
| M8Z95_RS08390 (M8Z95_08390) | 1805753..1805917 | - | 165 | WP_002439265.1 | hypothetical protein | - |
| M8Z95_RS08395 (M8Z95_08395) | 1805914..1806168 | - | 255 | WP_002505715.1 | helix-turn-helix transcriptional regulator | - |
| M8Z95_RS08400 (M8Z95_08400) | 1806362..1806691 | + | 330 | WP_002439260.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M8Z95_RS08405 (M8Z95_08405) | 1806703..1807164 | + | 462 | WP_002469232.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| M8Z95_RS08410 (M8Z95_08410) | 1807180..1807698 | + | 519 | WP_002505714.1 | hypothetical protein | - |
| M8Z95_RS08415 (M8Z95_08415) | 1807700..1808143 | + | 444 | WP_002439254.1 | hypothetical protein | - |
| M8Z95_RS08420 (M8Z95_08420) | 1808216..1808410 | + | 195 | WP_002439253.1 | hypothetical protein | - |
| M8Z95_RS08425 (M8Z95_08425) | 1808479..1808994 | + | 516 | WP_002439252.1 | hypothetical protein | - |
| M8Z95_RS08430 (M8Z95_08430) | 1808996..1809331 | + | 336 | WP_002439251.1 | hypothetical protein | - |
| M8Z95_RS08435 (M8Z95_08435) | 1809387..1809785 | + | 399 | Protein_1628 | phage integrase SAM-like domain-containing protein | - |
| M8Z95_RS08440 (M8Z95_08440) | 1809891..1810451 | + | 561 | WP_269770930.1 | site-specific integrase | - |
| M8Z95_RS08455 (M8Z95_08455) | 1810958..1811533 | - | 576 | WP_001829272.1 | competence protein ComK | - |
| M8Z95_RS08460 (M8Z95_08460) | 1811748..1811966 | + | 219 | WP_001829292.1 | IDEAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1803471..1810451 | 6980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18327.03 Da Isoelectric Point: 6.8511
>T245519 WP_002469232.1 NZ_CP097519:1806703-1807164 [Staphylococcus epidermidis]
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYEAALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYEAALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|