Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1806362..1807164 Replicon chromosome
Accession NZ_CP097519
Organism Staphylococcus epidermidis strain C066

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag M8Z95_RS08405 Protein ID WP_002469232.1
Coordinates 1806703..1807164 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag M8Z95_RS08400 Protein ID WP_002439260.1
Coordinates 1806362..1806691 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Z95_RS08350 (M8Z95_08350) 1801421..1801636 + 216 WP_001831694.1 NINE protein -
M8Z95_RS08355 (M8Z95_08355) 1802179..1802709 + 531 WP_002475755.1 N-acetyltransferase -
M8Z95_RS08360 (M8Z95_08360) 1803483..1803716 - 234 Protein_1613 AAA family ATPase -
M8Z95_RS08365 (M8Z95_08365) 1804095..1804322 + 228 WP_002505719.1 DUF2188 domain-containing protein -
M8Z95_RS08370 (M8Z95_08370) 1804319..1804522 - 204 WP_002505718.1 hypothetical protein -
M8Z95_RS08375 (M8Z95_08375) 1804537..1804749 - 213 Protein_1616 DUF771 domain-containing protein -
M8Z95_RS08380 (M8Z95_08380) 1804753..1805508 - 756 Protein_1617 phage regulatory protein/antirepressor Ant -
M8Z95_RS08385 (M8Z95_08385) 1805558..1805764 + 207 WP_002439266.1 hypothetical protein -
M8Z95_RS08390 (M8Z95_08390) 1805753..1805917 - 165 WP_002439265.1 hypothetical protein -
M8Z95_RS08395 (M8Z95_08395) 1805914..1806168 - 255 WP_002505715.1 helix-turn-helix transcriptional regulator -
M8Z95_RS08400 (M8Z95_08400) 1806362..1806691 + 330 WP_002439260.1 helix-turn-helix transcriptional regulator Antitoxin
M8Z95_RS08405 (M8Z95_08405) 1806703..1807164 + 462 WP_002469232.1 ImmA/IrrE family metallo-endopeptidase Toxin
M8Z95_RS08410 (M8Z95_08410) 1807180..1807698 + 519 WP_002505714.1 hypothetical protein -
M8Z95_RS08415 (M8Z95_08415) 1807700..1808143 + 444 WP_002439254.1 hypothetical protein -
M8Z95_RS08420 (M8Z95_08420) 1808216..1808410 + 195 WP_002439253.1 hypothetical protein -
M8Z95_RS08425 (M8Z95_08425) 1808479..1808994 + 516 WP_002439252.1 hypothetical protein -
M8Z95_RS08430 (M8Z95_08430) 1808996..1809331 + 336 WP_002439251.1 hypothetical protein -
M8Z95_RS08435 (M8Z95_08435) 1809387..1809785 + 399 Protein_1628 phage integrase SAM-like domain-containing protein -
M8Z95_RS08440 (M8Z95_08440) 1809891..1810451 + 561 WP_269770930.1 site-specific integrase -
M8Z95_RS08455 (M8Z95_08455) 1810958..1811533 - 576 WP_001829272.1 competence protein ComK -
M8Z95_RS08460 (M8Z95_08460) 1811748..1811966 + 219 WP_001829292.1 IDEAL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1803471..1810451 6980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(25-119)

Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18327.03 Da        Isoelectric Point: 6.8511

>T245519 WP_002469232.1 NZ_CP097519:1806703-1807164 [Staphylococcus epidermidis]
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYEAALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12735.32 Da        Isoelectric Point: 5.7917

>AT245519 WP_002439260.1 NZ_CP097519:1806362-1806691 [Staphylococcus epidermidis]
MRNNDEIITIIKSAMKEQDMSLSELARRVGVAKSAVSRYLNLTREFPLNRTEDFAKALSISTEYLLGFDKSEQQDEQPKH
RAAHLEGELTDEEWQRVLDYADYIRSKRK

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References