Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 800478..801007 | Replicon | chromosome |
Accession | NZ_CP097519 | ||
Organism | Staphylococcus epidermidis strain C066 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | M8Z95_RS03690 | Protein ID | WP_001829891.1 |
Coordinates | 800645..801007 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | M8Z95_RS03685 | Protein ID | WP_001829931.1 |
Coordinates | 800478..800648 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Z95_RS03660 (M8Z95_03660) | 796302..796781 | + | 480 | WP_002457111.1 | PH domain-containing protein | - |
M8Z95_RS03665 (M8Z95_03665) | 796774..798279 | + | 1506 | WP_002505951.1 | PH domain-containing protein | - |
M8Z95_RS03670 (M8Z95_03670) | 798266..798775 | + | 510 | WP_002457109.1 | PH domain-containing protein | - |
M8Z95_RS03675 (M8Z95_03675) | 798823..799176 | + | 354 | WP_002457108.1 | holo-ACP synthase | - |
M8Z95_RS03680 (M8Z95_03680) | 799243..800391 | + | 1149 | WP_002457107.1 | alanine racemase | - |
M8Z95_RS03685 (M8Z95_03685) | 800478..800648 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M8Z95_RS03690 (M8Z95_03690) | 800645..801007 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M8Z95_RS03695 (M8Z95_03695) | 801352..802353 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
M8Z95_RS03700 (M8Z95_03700) | 802453..802779 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
M8Z95_RS03705 (M8Z95_03705) | 802781..803260 | + | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
M8Z95_RS03710 (M8Z95_03710) | 803235..804005 | + | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T245517 WP_001829891.1 NZ_CP097519:800645-801007 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |