Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2106015..2106485 Replicon chromosome
Accession NZ_CP097514
Organism Staphylococcus epidermidis strain C034

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag M8Z30_RS10060 Protein ID WP_001829569.1
Coordinates 2106297..2106485 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag M8Z30_RS10055 Protein ID WP_002438963.1
Coordinates 2106015..2106272 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Z30_RS10015 (M8Z30_10015) 2101379..2102095 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
M8Z30_RS10020 (M8Z30_10020) 2102256..2102678 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
M8Z30_RS10025 (M8Z30_10025) 2102862..2102999 - 138 WP_162161215.1 hypothetical protein -
M8Z30_RS10030 (M8Z30_10030) 2103029..2103216 - 188 Protein_1950 hypothetical protein -
M8Z30_RS10035 (M8Z30_10035) 2103603..2104103 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
M8Z30_RS10040 (M8Z30_10040) 2104374..2104961 - 588 WP_001829615.1 histidine phosphatase family protein -
M8Z30_RS10045 (M8Z30_10045) 2105175..2105411 + 237 WP_002457224.1 hypothetical protein -
M8Z30_RS10050 (M8Z30_10050) 2105403..2105606 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
M8Z30_RS10055 (M8Z30_10055) 2106015..2106272 + 258 WP_002438963.1 hypothetical protein Antitoxin
M8Z30_RS10060 (M8Z30_10060) 2106297..2106485 + 189 WP_001829569.1 hypothetical protein Toxin
M8Z30_RS10065 (M8Z30_10065) 2106675..2107229 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
M8Z30_RS10070 (M8Z30_10070) 2107289..2107522 - 234 WP_001829664.1 hypothetical protein -
M8Z30_RS10075 (M8Z30_10075) 2107806..2108552 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
M8Z30_RS10080 (M8Z30_10080) 2108651..2108935 + 285 WP_001829635.1 hypothetical protein -
M8Z30_RS10085 (M8Z30_10085) 2108959..2109183 + 225 WP_001829613.1 hypothetical protein -
M8Z30_RS10090 (M8Z30_10090) 2109804..2110004 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2102862..2103017 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T245515 WP_001829569.1 NZ_CP097514:2106297-2106485 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT245515 WP_002438963.1 NZ_CP097514:2106015-2106272 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References