Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2106022..2106492 Replicon chromosome
Accession NZ_CP097512
Organism Staphylococcus epidermidis strain C019

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag M8Z31_RS10065 Protein ID WP_001829569.1
Coordinates 2106304..2106492 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag M8Z31_RS10060 Protein ID WP_002438963.1
Coordinates 2106022..2106279 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Z31_RS10020 (M8Z31_10020) 2101386..2102102 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
M8Z31_RS10025 (M8Z31_10025) 2102263..2102685 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
M8Z31_RS10030 (M8Z31_10030) 2102869..2103006 - 138 WP_162161215.1 hypothetical protein -
M8Z31_RS10035 (M8Z31_10035) 2103036..2103223 - 188 Protein_1950 hypothetical protein -
M8Z31_RS10040 (M8Z31_10040) 2103610..2104110 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
M8Z31_RS10045 (M8Z31_10045) 2104381..2104968 - 588 WP_001829615.1 histidine phosphatase family protein -
M8Z31_RS10050 (M8Z31_10050) 2105182..2105418 + 237 WP_002457224.1 hypothetical protein -
M8Z31_RS10055 (M8Z31_10055) 2105410..2105613 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
M8Z31_RS10060 (M8Z31_10060) 2106022..2106279 + 258 WP_002438963.1 hypothetical protein Antitoxin
M8Z31_RS10065 (M8Z31_10065) 2106304..2106492 + 189 WP_001829569.1 hypothetical protein Toxin
M8Z31_RS10070 (M8Z31_10070) 2106682..2107236 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
M8Z31_RS10075 (M8Z31_10075) 2107296..2107529 - 234 WP_001829664.1 hypothetical protein -
M8Z31_RS10080 (M8Z31_10080) 2107813..2108559 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
M8Z31_RS10085 (M8Z31_10085) 2108658..2108942 + 285 WP_001829635.1 hypothetical protein -
M8Z31_RS10090 (M8Z31_10090) 2108966..2109190 + 225 WP_001829613.1 hypothetical protein -
M8Z31_RS10095 (M8Z31_10095) 2109811..2110011 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2102869..2103024 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T245511 WP_001829569.1 NZ_CP097512:2106304-2106492 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT245511 WP_002438963.1 NZ_CP097512:2106022-2106279 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References