Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 868129..868658 | Replicon | chromosome |
Accession | NZ_CP097512 | ||
Organism | Staphylococcus epidermidis strain C019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | M8Z31_RS04015 | Protein ID | WP_001829891.1 |
Coordinates | 868296..868658 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | M8Z31_RS04010 | Protein ID | WP_001829931.1 |
Coordinates | 868129..868299 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Z31_RS03985 (M8Z31_03985) | 863954..864433 | + | 480 | WP_001829909.1 | PH domain-containing protein | - |
M8Z31_RS03990 (M8Z31_03990) | 864426..865931 | + | 1506 | WP_001829976.1 | PH domain-containing protein | - |
M8Z31_RS03995 (M8Z31_03995) | 865918..866427 | + | 510 | WP_001829888.1 | PH domain-containing protein | - |
M8Z31_RS04000 (M8Z31_04000) | 866475..866828 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
M8Z31_RS04005 (M8Z31_04005) | 866894..868042 | + | 1149 | WP_002468951.1 | alanine racemase | - |
M8Z31_RS04010 (M8Z31_04010) | 868129..868299 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M8Z31_RS04015 (M8Z31_04015) | 868296..868658 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M8Z31_RS04020 (M8Z31_04020) | 869004..870005 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
M8Z31_RS04025 (M8Z31_04025) | 870105..870431 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
M8Z31_RS04030 (M8Z31_04030) | 870433..870912 | + | 480 | WP_002484520.1 | anti-sigma B factor RsbW | - |
M8Z31_RS04035 (M8Z31_04035) | 870887..871657 | + | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T245509 WP_001829891.1 NZ_CP097512:868296-868658 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |