Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 73779..74472 | Replicon | plasmid pBYT5-2 |
| Accession | NZ_CP097491 | ||
| Organism | Pseudomonas sp. BYT-5 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | M6G63_RS27425 | Protein ID | WP_003151133.1 |
| Coordinates | 73779..74156 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | M6G63_RS27430 | Protein ID | WP_001172026.1 |
| Coordinates | 74137..74472 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G63_RS27410 (M6G63_27410) | 69031..69948 | + | 918 | Protein_78 | Tn3 family transposase | - |
| M6G63_RS27415 (M6G63_27415) | 69972..73001 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
| M6G63_RS27420 (M6G63_27420) | 72985..73587 | - | 603 | WP_010465829.1 | recombinase family protein | - |
| M6G63_RS27425 (M6G63_27425) | 73779..74156 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M6G63_RS27430 (M6G63_27430) | 74137..74472 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M6G63_RS27435 (M6G63_27435) | 74487..74822 | + | 336 | WP_000741275.1 | hypothetical protein | - |
| M6G63_RS27440 (M6G63_27440) | 74846..75172 | + | 327 | WP_000091614.1 | hypothetical protein | - |
| M6G63_RS27445 (M6G63_27445) | 75188..75529 | + | 342 | WP_025999701.1 | hypothetical protein | - |
| M6G63_RS27450 (M6G63_27450) | 75569..76837 | + | 1269 | Protein_86 | Tn3 family transposase | - |
| M6G63_RS27455 (M6G63_27455) | 76834..77274 | - | 441 | WP_250035703.1 | DUF1924 domain-containing protein | - |
| M6G63_RS27460 (M6G63_27460) | 77415..79010 | + | 1596 | WP_250035718.1 | 2Fe-2S iron-sulfur cluster-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..136400 | 136400 | |
| - | inside | IScluster/Tn | - | - | 69061..81408 | 12347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T245506 WP_003151133.1 NZ_CP097491:73779-74156 [Pseudomonas sp. BYT-5]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |