245505

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tad-ata/COG5606-COG4679
Location 2800215..2800908 Replicon chromosome
Accession NZ_CP097489
Organism Pseudomonas sp. BYT-5

Toxin (Protein)


Gene name tad Uniprot ID N2IHR9
Locus tag M6G63_RS12850 Protein ID WP_003151133.1
Coordinates 2800215..2800592 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name ata Uniprot ID N2IIN5
Locus tag M6G63_RS12855 Protein ID WP_001172026.1
Coordinates 2800573..2800908 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M6G63_RS12810 (M6G63_12810) 2795552..2795758 + 207 Protein_2533 Tn3 family transposase -
M6G63_RS12815 (M6G63_12815) 2795794..2796231 - 438 Protein_2534 DNA-binding protein -
M6G63_RS12820 (M6G63_12820) 2796411..2797388 + 978 WP_250033546.1 site-specific integrase -
M6G63_RS12825 (M6G63_12825) 2797417..2797986 - 570 WP_250033550.1 DUF4946 domain-containing protein -
M6G63_RS12830 (M6G63_12830) 2797973..2798491 - 519 WP_045665860.1 ATP-dependent zinc protease -
M6G63_RS12835 (M6G63_12835) 2798585..2798845 - 261 WP_250033552.1 hypothetical protein -
M6G63_RS12840 (M6G63_12840) 2798933..2799757 - 825 Protein_2539 cation diffusion facilitator family transporter -
M6G63_RS12845 (M6G63_12845) 2799928..2800107 + 180 Protein_2540 MerR family transcriptional regulator -
M6G63_RS12850 (M6G63_12850) 2800215..2800592 + 378 WP_003151133.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M6G63_RS12855 (M6G63_12855) 2800573..2800908 + 336 WP_001172026.1 helix-turn-helix transcriptional regulator Antitoxin
M6G63_RS12860 (M6G63_12860) 2800923..2801258 + 336 WP_000741275.1 hypothetical protein -
M6G63_RS12865 (M6G63_12865) 2801282..2801608 + 327 WP_000091614.1 hypothetical protein -
M6G63_RS12870 (M6G63_12870) 2801624..2801965 + 342 WP_025999701.1 hypothetical protein -
M6G63_RS12875 (M6G63_12875) 2802006..2802296 + 291 WP_004423344.1 hypothetical protein -
M6G63_RS12880 (M6G63_12880) 2802293..2802637 + 345 WP_004423345.1 IS66 family insertion sequence element accessory protein TnpB -
M6G63_RS12885 (M6G63_12885) 2802759..2804297 + 1539 WP_011911868.1 IS66 family transposase -
M6G63_RS12890 (M6G63_12890) 2804287..2804556 + 270 WP_003458515.1 hypothetical protein -
M6G63_RS12895 (M6G63_12895) 2804742..2805071 - 330 WP_032489165.1 four-helix bundle copper-binding protein -
M6G63_RS12900 (M6G63_12900) 2805264..2805350 + 87 Protein_2551 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2770482..2800908 30426
- flank IS/Tn - - 2795573..2795758 185


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-109)

Antitoxin

Cro/C1-type helix-turn-helix domain

(40-93)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13705.78 Da        Isoelectric Point: 9.4693

>T245505 WP_003151133.1 NZ_CP097489:2800215-2800592 [Pseudomonas sp. BYT-5]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH

Download         Length: 378 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12201.39 Da        Isoelectric Point: 10.6058

>AT245505 WP_001172026.1 NZ_CP097489:2800573-2800908 [Pseudomonas sp. BYT-5]
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A024ELN5

Antitoxin

Source ID Structure
AlphaFold DB A0A024EKI7

References