Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1665682..1666395 Replicon chromosome
Accession NZ_CP097484
Organism Methylobacterium tardum strain DSM 19566

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M6G65_RS07815 Protein ID WP_238196388.1
Coordinates 1665682..1665891 (+) Length 70 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M6G65_RS07820 Protein ID WP_238196389.1
Coordinates 1665970..1666395 (+) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M6G65_RS07790 (M6G65_07790) 1661638..1661823 + 186 WP_250103793.1 hypothetical protein -
M6G65_RS07795 (M6G65_07795) 1661892..1662287 - 396 WP_238196384.1 hypothetical protein -
M6G65_RS07800 (M6G65_07800) 1662905..1663120 + 216 WP_238196385.1 hypothetical protein -
M6G65_RS07805 (M6G65_07805) 1663176..1664219 + 1044 WP_238196386.1 hypothetical protein -
M6G65_RS07810 (M6G65_07810) 1664694..1665143 + 450 WP_238196387.1 hypothetical protein -
M6G65_RS33410 1665407..1665541 - 135 WP_283214850.1 hypothetical protein -
M6G65_RS07815 (M6G65_07815) 1665682..1665891 + 210 WP_238196388.1 type II toxin-antitoxin system HicA family toxin Toxin
M6G65_RS07820 (M6G65_07820) 1665970..1666395 + 426 WP_238196389.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M6G65_RS07825 (M6G65_07825) 1666794..1666958 + 165 WP_238196390.1 hypothetical protein -
M6G65_RS07830 (M6G65_07830) 1666955..1667386 + 432 WP_238196391.1 MerR family transcriptional regulator -
M6G65_RS07835 (M6G65_07835) 1668005..1668514 + 510 WP_238196458.1 PAN domain-containing protein -
M6G65_RS07840 (M6G65_07840) 1668754..1669119 + 366 WP_238196392.1 helix-turn-helix domain-containing protein -
M6G65_RS07845 (M6G65_07845) 1669307..1669474 + 168 WP_250103794.1 hypothetical protein -
M6G65_RS07850 (M6G65_07850) 1669499..1669765 + 267 WP_238196394.1 hypothetical protein -
M6G65_RS07855 (M6G65_07855) 1669780..1669959 + 180 WP_250103795.1 hypothetical protein -
M6G65_RS07860 (M6G65_07860) 1669997..1670281 + 285 WP_250103796.1 hypothetical protein -
M6G65_RS07865 (M6G65_07865) 1670345..1670548 + 204 WP_238196397.1 hypothetical protein -
M6G65_RS07870 (M6G65_07870) 1670620..1671012 + 393 WP_238196398.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1659373..1688164 28791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(11-67)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(8-126)


Sequences

Toxin        


Download         Length: 70 a.a.        Molecular weight: 7771.81 Da        Isoelectric Point: 10.6691

>T245504 WP_238196388.1 NZ_CP097484:1665682-1665891 [Methylobacterium tardum]
MSAKSHSRKTRDVIAALHKDGWNVIRNGPGDHIQFKHPIKPGRISIDNGEPEIPTGTLRSIYRAAGWEW

Download         Length: 210 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15010.72 Da        Isoelectric Point: 4.4412

>AT245504 WP_238196389.1 NZ_CP097484:1665970-1666395 [Methylobacterium tardum]
MTNVVMFIHEENGSYGASFPDFPGATTVAGDLDTLYRKAAEMLVFHVGGMAEDGDDIASPRTLDQLRADPAFQEDSEGAL
IGLVRVDLPGRSVRVNISMEESLLKRVDRAAEASGESRSGFLAQAAKARLSTHSGTTPPAE

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References