Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1665682..1666395 | Replicon | chromosome |
| Accession | NZ_CP097484 | ||
| Organism | Methylobacterium tardum strain DSM 19566 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M6G65_RS07815 | Protein ID | WP_238196388.1 |
| Coordinates | 1665682..1665891 (+) | Length | 70 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M6G65_RS07820 | Protein ID | WP_238196389.1 |
| Coordinates | 1665970..1666395 (+) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G65_RS07790 (M6G65_07790) | 1661638..1661823 | + | 186 | WP_250103793.1 | hypothetical protein | - |
| M6G65_RS07795 (M6G65_07795) | 1661892..1662287 | - | 396 | WP_238196384.1 | hypothetical protein | - |
| M6G65_RS07800 (M6G65_07800) | 1662905..1663120 | + | 216 | WP_238196385.1 | hypothetical protein | - |
| M6G65_RS07805 (M6G65_07805) | 1663176..1664219 | + | 1044 | WP_238196386.1 | hypothetical protein | - |
| M6G65_RS07810 (M6G65_07810) | 1664694..1665143 | + | 450 | WP_238196387.1 | hypothetical protein | - |
| M6G65_RS33410 | 1665407..1665541 | - | 135 | WP_283214850.1 | hypothetical protein | - |
| M6G65_RS07815 (M6G65_07815) | 1665682..1665891 | + | 210 | WP_238196388.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M6G65_RS07820 (M6G65_07820) | 1665970..1666395 | + | 426 | WP_238196389.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M6G65_RS07825 (M6G65_07825) | 1666794..1666958 | + | 165 | WP_238196390.1 | hypothetical protein | - |
| M6G65_RS07830 (M6G65_07830) | 1666955..1667386 | + | 432 | WP_238196391.1 | MerR family transcriptional regulator | - |
| M6G65_RS07835 (M6G65_07835) | 1668005..1668514 | + | 510 | WP_238196458.1 | PAN domain-containing protein | - |
| M6G65_RS07840 (M6G65_07840) | 1668754..1669119 | + | 366 | WP_238196392.1 | helix-turn-helix domain-containing protein | - |
| M6G65_RS07845 (M6G65_07845) | 1669307..1669474 | + | 168 | WP_250103794.1 | hypothetical protein | - |
| M6G65_RS07850 (M6G65_07850) | 1669499..1669765 | + | 267 | WP_238196394.1 | hypothetical protein | - |
| M6G65_RS07855 (M6G65_07855) | 1669780..1669959 | + | 180 | WP_250103795.1 | hypothetical protein | - |
| M6G65_RS07860 (M6G65_07860) | 1669997..1670281 | + | 285 | WP_250103796.1 | hypothetical protein | - |
| M6G65_RS07865 (M6G65_07865) | 1670345..1670548 | + | 204 | WP_238196397.1 | hypothetical protein | - |
| M6G65_RS07870 (M6G65_07870) | 1670620..1671012 | + | 393 | WP_238196398.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1659373..1688164 | 28791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 70 a.a. Molecular weight: 7771.81 Da Isoelectric Point: 10.6691
>T245504 WP_238196388.1 NZ_CP097484:1665682-1665891 [Methylobacterium tardum]
MSAKSHSRKTRDVIAALHKDGWNVIRNGPGDHIQFKHPIKPGRISIDNGEPEIPTGTLRSIYRAAGWEW
MSAKSHSRKTRDVIAALHKDGWNVIRNGPGDHIQFKHPIKPGRISIDNGEPEIPTGTLRSIYRAAGWEW
Download Length: 210 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15010.72 Da Isoelectric Point: 4.4412
>AT245504 WP_238196389.1 NZ_CP097484:1665970-1666395 [Methylobacterium tardum]
MTNVVMFIHEENGSYGASFPDFPGATTVAGDLDTLYRKAAEMLVFHVGGMAEDGDDIASPRTLDQLRADPAFQEDSEGAL
IGLVRVDLPGRSVRVNISMEESLLKRVDRAAEASGESRSGFLAQAAKARLSTHSGTTPPAE
MTNVVMFIHEENGSYGASFPDFPGATTVAGDLDTLYRKAAEMLVFHVGGMAEDGDDIASPRTLDQLRADPAFQEDSEGAL
IGLVRVDLPGRSVRVNISMEESLLKRVDRAAEASGESRSGFLAQAAKARLSTHSGTTPPAE
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|